SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000376024 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000376024
Domain Number 1 Region: 227-358
Classification Level Classification E-value
Superfamily PX domain 3.14e-27
Family PX domain 0.002
Further Details:      
 
Domain Number 2 Region: 1-69
Classification Level Classification E-value
Superfamily SH3-domain 7.88e-16
Family SH3-domain 0.0013
Further Details:      
 
Domain Number 3 Region: 384-587
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0000872
Family BAR domain 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000376024
Sequence length 590
Comment SNX9 (Homo_sapiens) sorting nexin 9
Sequence
ARVMYDFAAEPGNNELTVSEGEIITITNPDVGGGWLEGRNSKGERGLVPTDYVEILPNDG
KDPFSCGNSVADQAFLDSLSASIAQTSSSAVNSNNQVSGGSDPWSAWNAPKSGNWESSDG
WGARQEGAGAQKNTANNWDTAFGHPQAYQGPAAGDDDEWDEDWDDPKSSSPYFKDPESAE
TGGVQRGNSRPGASSMKLPLNKFPGFAKPGMEQYLLAKQLAKPKEKIPIIVGDYGPMWVY
PTSTFDCVVADPRKGSKMYGLKSYIEYQLTPTNTNRSVNHRYKHFDWLYERLLVKFGSAI
PIPSLPDKQVTGRFEEEFIKMRMERLQAWMTRMCRHPVISESEVFQQFLNFRDEKEWKTG
KRKAEKDEVVGVMIFSTMEPEAPDLDLIEIEQKCEAVGKFTKAMDDGVKELLTVGQEHWK
RCTGPLPKEYQKIGKALQSLATVFSSSGYQGETDLNNAITEAGKTYEEIASLVAEQPKKD
LHFLMECNHEYKGFLGCFPDIIGAHKGAIEKVKESDKLVATSKITPQDKQTMVKRVGTMS
YALQAEMNHFHSNRIYDYNSVIRLYLEQQVHFYETIAEKLRQALSRFPVM
Download sequence
Identical sequences G5B2S3
HGL_H00000376024

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]