SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000376290-5 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000376290-5
Domain Number 1 Region: 164-278
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 4.43e-30
Family Canonical RBD 0.0000315
Further Details:      
 
Weak hits

Sequence:  HGL_H00000376290-5
Domain Number - Region: 103-139
Classification Level Classification E-value
Superfamily Vasodilator-stimulated phosphoprotein, VASP, tetramerisation domain 0.017
Family Vasodilator-stimulated phosphoprotein, VASP, tetramerisation domain 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000376290-5
Sequence length 327
Comment TRA2B (Homo_sapiens) transformer 2 beta homolog (Drosophila)
Sequence
MPWQQSTGHAPHPLLLCTATWFHTTKMQRTQDHQTTALSPATPGPEIRGGNLCRHQKPTP
PVKMRKHINKSQNQTSRSPTATPKGNKMEHSDTQTPGPTELETKGDLEKMKSEIISQITG
EIVPLVQDMINKSREELRSYSRDYRRRHSHSHSPMSSRRHHVGNRANPDPNLCLGVFGLS
LYTSERDLREVFSKYGPIADVSIGCNQQSRRSRGFAFVCFENVDDAKEAKECANGMEPDG
RRIRVGFSITKRPHTPTPGIYMGRPTYGSSRRRDYSDRGYDRGYDDRDYYSRSYRGGGGG
GGGCRAAQDRDQIDRRWSTSPYYSHGG
Download sequence
Identical sequences G5C1J5
HGL_H00000376290-5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]