SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000376306 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000376306
Domain Number 1 Region: 78-412
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.62e-81
Family Protein kinases, catalytic subunit 0.00000443
Further Details:      
 
Domain Number 2 Region: 1376-1441
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000000000164
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.011
Further Details:      
 
Domain Number 3 Region: 1460-1591
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000487
Family Pleckstrin-homology domain (PH domain) 0.023
Further Details:      
 
Weak hits

Sequence:  HGL_H00000376306
Domain Number - Region: 614-792
Classification Level Classification E-value
Superfamily Tropomyosin 0.000628
Family Tropomyosin 0.0012
Further Details:      
 
Domain Number - Region: 447-612
Classification Level Classification E-value
Superfamily Tropomyosin 0.0569
Family Tropomyosin 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000376306
Sequence length 2083
Comment CIT (Homo_sapiens) citron (rho-interacting, serine/threonine kinase 21)
Sequence
MLKFKYGARNPLDAGAVEPITSRASRLNLFFQGKPPFMTQQQMSALSREGILDALFVLFE
ECSQPALMKIKHVSNFVRKYSDIIAELQELQPSAKDFEVKSLVGCGHFAEVQVVRERATG
DIYAMKIMKKKALLAQEQVSFFEEEQNILSRSTSPWIPQLQYAFQDKNNLYLVMEYQPGG
DLLSLLNRYEDQLDENMIQFYLAELILAVHSVHQMGYVHRDIKPENVLIDRMGHIKLVDF
GSAAKMNSNKVVNAKLPIGTPDYMAPEVLTAMNGDGKGTYGLDCDWWSVGVIAYEMAYGR
TPFTEGTSARTFNNIMNFQRFLKFPDDPKVSSEYLDLIQSLLCGQKERLKFEGLCCHPFF
SKMDWNDIRNSPPPFVPTLKSDDDISNFDEPEKNSWVSSSPCQLSPSGFSGEELPFVGFS
YSKALGILGRSESVVSSLDSPAKTSSMEKKLLIKSKELQDSQDKCHKMEQEMTRLHRRVS
EVEAVLSQKEVELKASETQRSLLEQDLATYITECSSLKRSLEQARMEVSQEDDKALQLLH
DIREQSRKLQEIKEQEYQAQVEEMRLMMNQLEEDLVSARRRSDLYESELRESRLAAEEFK
RKATECQHKLIKAKDQGKPEVGEYSKLEKINAEQQLKIQELQEKLEKAVKASTEATELLQ
NIRQAKERAERELEKLQNREDSSEGIRKKLVEAEERRHSLENKVKRLETMERRENRLKDD
IQTKSQQIQQMADKILELEEKHREAQVSAQHLEVHLKQKEQHYEEKIKVLDNQIKKDLAD
KESLENLMQRHEEEAHEKGKILSEQKAMINAMDSKIRSLEQRIVELSEANKLAANSSLFT
QRNMKAQEEMISELRQQKFYLETQAGKLEAQNRKLEEQLEKISHQDHSDKNRLLELETRL
REVSLEHEEQKLELKRQLTELQLSLQERESQLTALQAARAALESQLRQAKTELEETTAEA
EEEIQALTAHRDEIQRKFDALRNSCTVITDLEEQLNQLTEDNAELNNQNFYLSKQLDEAS
GANDEIVQLRSEVDHLRREITEREMQLTSQKQTMEALKTTCTMLEEQVMDLEALNDELLE
KERQWEAWRSVLGDEKSQFECRVRELQRMLDTEKQSRARADQRITESRQVVELAVKEHKA
EILALQQALKEQKLKAESLSDKLNDLEKKHAMLEMNARSLQQKLETERELKQRLLEEQAK
LQQQMDLQKNHIFRLTQGLQEALDRADLLKTERSDLEYQLENIQVLYSHEKVKMEGTISQ
QTKLIDFLQAKMDQPAKKKKVPLQYNELKLALEKEKARCAELEEALQKTRIELRSAREEA
AHRKATDHPHPSTPATARQQIAMSAIVRSPEHQPSAMSLLAPPSSRRKESSTPEEFSRRL
KERMHHNIPHRFNVGLNMRATKCAVCLDTVHFGRQASKCLECQVMCHPKCSTCLPATCGL
PAEYATHFTEAFCRDKMNSPGLQSKEPSSSLHLEGWMKVPRNNKRGQQGWDRKYIVLEGS
KVLIYDSEAREAGQRPVEEFELCLPDGDVSIHGAVGASELANTAKADVPYILKMESHPHT
TCWPGRTLYLLAPSFPDKQRWVTALESVVAGGRVSREKAEADAKLLGNSLLKLEGDDRLD
MNCTLPFSDQVVLVGTEEGLYALNVLKNSLTHVPGIGAVFQIYIIKDLEKLLMIAGEERA
LCLVDVKKVKQSLAQSHLPAQPDISPNIFEAVKGCHLFGAGKIENSLCICAAMPSKVVIL
RYNENLGKYCIRKEIETSEPCSCIHFTNYSILIGTNKFYEIDMKQYTLEEFLDKNDHSLA
PAVFASSSNSFPVSIVQVNSAGQREEYLLCFHEFGVFVDSYGRRSRTDDLKWSRLPLAFA
YREPYLFVTHFNSLEVIEIQARSSLGTPARAYLEIPNPRYLGPAISSGAIYLASSYQDKL
RVICCKGNLVKESGTEHHRVPSTSRSSPNKRGPPTYNEHITKRVASSPAPPEGPSHPREP
STPHRYREGRTELRRDKSPGRPLEREKSPGRMLSTRRERSPGRLFEDSSRGRLPVGAVRT
PLSQVNKDVDAEKPEEGKSKAGEKELESDQMSTSREEEIISTD
Download sequence
Identical sequences G5B786
HGL_H00000376306

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]