SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000376344 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000376344
Domain Number 1 Region: 396-485,578-651
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 4.21e-33
Family Canonical RBD 0.0000161
Further Details:      
 
Domain Number 2 Region: 720-807
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.48e-24
Family Canonical RBD 0.0000566
Further Details:      
 
Domain Number 3 Region: 822-907
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 4.43e-21
Family Canonical RBD 0.00000779
Further Details:      
 
Domain Number 4 Region: 3-87
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 3.09e-19
Family Canonical RBD 0.0037
Further Details:      
 
Domain Number 5 Region: 281-364
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.96e-17
Family Canonical RBD 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000376344
Sequence length 955
Comment RBM19 (Homo_sapiens) RNA binding motif protein 19
Sequence
MSRLIVKNLPSGMKEERFRQLFAAFGTLTDCSLKFTKDGKFRKFGFIGFKSEVEAQRALS
HFNKCFIDTARITVEFCKSFGDPTKPRAWSKHAQKPSEPKKSQKDSACPETKKEKKKREP
SELEKLKEDTEFQEFLSVHQKRTQVATWANDALDTELPRGKGKSASDYLNFDSDSGQESE
EEEEEEEAAGEELEGEQDLKPKAAVQKELSDMDYLKSKMVQAGSVSSLEEESEDEAMNCD
EESEAKEEEETERRAASPGHRAPPEHGRPQDSRAESEKPTNQKEPTTCHTVKLRGAPFNV
TEKNVTEFLAPLKPVAIRIVRNAHGNKTGYIFVDFSSEEEVKKALKCNREYMGGRYIEVF
REKQVPMAKEPLKSSTKAWQGRMLGENEEEEDLADSGRLFVRNLPYTSTEEDLEKLFSTY
GPLSELHFPIDSLTKKPKGFAFVTFLFPEHAVKAYSAVDGQVFQGRMLHVLPSTIRKEAS
EEAGAPGSSYKRKKDSKDKANSASSHNWNTLFMGPNAVADAIARKYNATKSQVFDHETKG
SVAVRVALGETQLVQEVRRFLLDNGVCLDSFSQAAAERSKTVILAKNLPAGTLAAELQET
FGRFGSLGRVLLPEGGVTAIVEFLEPLEARKAFRHLAYSKFHHVPLYLEWAPISIFSSTA
PQEKAPQNPPAEPAGKDRAEPEAVADSETPGTGKPAEERAAASTTKMEEEEEQEEEEENE
SLPGCTLFIKNLNFDTTEETLKEVFSKAGAVRSCSVSKKKNKEGALLSMGFGFVEYRKPE
HAQKALRQLQGHVVDGHKLELRISERATRPALTSSRKKQVPRKQTTSKILVRNIPFQASL
REIRELFSTFGELKTVRLPKKMTGTGAHRGFGFVDFLTKQDAKRAFNALCHSTHLYGRRL
VLEWADSEVTLQTLRRKTAEHFHEPPKKKQSAVLDGILGQLEDSESDGEEQTLQL
Download sequence
Identical sequences G5AKX5
HGL_H00000376344 XP_004843784.1.39548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]