SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000376350 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000376350
Domain Number 1 Region: 441-593,627-692
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00000000228
Family Voltage-gated potassium channels 0.023
Further Details:      
 
Domain Number 2 Region: 137-325
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0000000212
Family Voltage-gated potassium channels 0.016
Further Details:      
 
Weak hits

Sequence:  HGL_H00000376350
Domain Number - Region: 341-432
Classification Level Classification E-value
Superfamily EF-hand 0.0092
Family Calmodulin-like 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000376350
Sequence length 819
Comment TPCN1 (Homo_sapiens) two pore segment channel 1
Sequence
MAVNLDDDVPLILTMDEGCSAPAASSNSLGPEQLPSRNGGSHTIPDSRAPSLVSGGENSP
ASPTPHDWEMNYQEAAIYLQEGENNDKFFTHPKDAKALAAYLFAHNHVFYLMELLTALLL
LLLTLCEAPAVPALRLGIYVHATLELFALMVVVCELCMKLRWLGLHTFVRHKRTMVKTSV
LVVQFVEAIVVLVRQTSHVRVTRALRCIFLVDCRYCGGVRRNLRQIFQSLPPFMDILLLL
LFFMIIFAILGFYLFSPNPSDPYFSTLENSIVSLFVLLTTANFPDVMMPSYSRNPWSCVF
FIVYLSIELYFIMNLLLAVVFDTFNDIEKRKFKSLLLHKRTAIQHAFRLLTSQRRPSGIS
YRQFEGLMRFYKPRMSARERFLTFKALNQSNKPLLSLEDFCDIYEIATLKWKAKRNREHW
FDELPRTAFLIFKGINILVQSKAFQYFMYLVVAVNGMWILVETFMLKGGNFFPKHVPWSY
LVFLTIYGVELFLKVAGFGPVEYLSSGWNLFDFSVTVFAFLGLLALALNMEPFYFIVVLR
PLQLLRLFKLKKRYRNVLDTMFELLPRMASLGLTLLIFYYSFAIVGMEFFCGLLYPNCCN
TSTVADAYRWLNHTVGDKTVVEEGYYYLNNFDNILNSFVTLFELTVVNNWYIIMEGVTSQ
TSHWSRLYFMTFYIVTMVVMTIIVAFILEAFVFRMNYSRKSQDSEVDGGITLEKEISKEE
LVAILELYRGARGASSSVTQLLETLSQMEKYQQNSLVFLGRRSRTKSDLSLKMYQEEIQE
WYTEHAREQEAQRQQLSSSGTVPTTQQPPGSRQRSQTIT
Download sequence
Identical sequences G5AKW7
XP_004843794.1.39548 XP_004843796.1.39548 XP_012927208.1.39548 XP_012927209.1.39548 HGL_H00000376350

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]