SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000376440 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000376440
Domain Number 1 Region: 1-127
Classification Level Classification E-value
Superfamily DNA clamp 0.000000000115
Family DNA polymerase processivity factor 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000376440
Sequence length 400
Comment RAD9B (Homo_sapiens) RAD9 homolog B (S. pombe)
Sequence
VFGKAIQALSRVSDELWLDPSEKGVTILFFKLALRSLNSSSSACGYVLFSSVFFEHYQWS
ASKEMNDDGRSLYLNCKLGMKSILPIFRCVNSFERYVEKCKIFTTSDKCKVVIQFFCRHG
IKKTHNVCFQESSPLQVNFEKKMCCNTLMIQPRLLAEAMVLFSSNEDVTLAVSPLNLCLK
SAHGELADLTNSVYSEMLVGPDEFDFFQVGLDTEITFCCKELKGMLIFSEAVHVPMSIHF
DFPGKPVALSIVDMLLEANFILATLAGNSSRSCSPQSLCLSQAGKRSDWRQLNSKAGQRG
MHKPPECISRKTTPKRLCPQGTPVKNSAAEDHGSPQLKKANLDNIHEVPRSSVGDTEEEP
NSFSRRKFSSMFFGAVSSDQQEHLNQPFASLAMASDSEDD
Download sequence
Identical sequences G5AWM1
HGL_H00000376440

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]