SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000376500 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000376500
Domain Number 1 Region: 413-563
Classification Level Classification E-value
Superfamily TRAF domain-like 2.62e-50
Family MATH domain 0.0000000357
Further Details:      
 
Domain Number 2 Region: 363-412
Classification Level Classification E-value
Superfamily Trimerization domain of TRAF 9.68e-21
Family Trimerization domain of TRAF 0.0000931
Further Details:      
 
Domain Number 3 Region: 111-210
Classification Level Classification E-value
Superfamily TRAF domain-like 0.00000000000000314
Family SIAH, seven in absentia homolog 0.049
Further Details:      
 
Domain Number 4 Region: 42-98
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000625
Family RING finger domain, C3HC4 0.011
Further Details:      
 
Domain Number 5 Region: 211-252
Classification Level Classification E-value
Superfamily TRAF domain-like 0.0000163
Family SIAH, seven in absentia homolog 0.011
Further Details:      
 
Weak hits

Sequence:  HGL_H00000376500
Domain Number - Region: 269-409
Classification Level Classification E-value
Superfamily Tropomyosin 0.00327
Family Tropomyosin 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000376500
Sequence length 567
Comment TRAF3 (Homo_sapiens) TNF receptor-associated factor 3
Sequence
MEPSKKMDSAGTLQTNPPLKLQPDRSAGSVFVPEQGGYKEKFVKAVEDKYKCEKCRLVLC
NPKQTECGHRFCESCMAALLSSSSPKCTACQEGIVKEKVFKDNCCRREILALQICCRNEG
RGCSEQLTLGHLLVHLKNDCQFEELPCLRADCREKVLRRDLRDHVEKACKYREATCTHCK
SQVPMIKLQKHEDSECPCVVVSCPHKCSVQTLLRSELSAHLSECVNAPSTCSFKRYGCVF
QGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFEIE
IERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNRV
TELESVDKSAGQAARNTGLLESQLSRHDQMLSVHDIRLADMDLRFQVLETASYNGVLIWK
IRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGE
YDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFVAQT
VLENGTYIKDDTIFIKVIVDTSDLPDP
Download sequence
Identical sequences A0A0N8ET26
HGL_H00000376500 XP_004836967.1.39548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]