SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000376616 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000376616
Domain Number 1 Region: 653-710
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.96e-20
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 2 Region: 597-654
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3e-19
Family Classic zinc finger, C2H2 0.008
Further Details:      
 
Domain Number 3 Region: 376-432
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.26e-19
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 
Domain Number 4 Region: 695-747
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.87e-18
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 5 Region: 541-598
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.85e-16
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 6 Region: 319-376
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000485
Family Classic zinc finger, C2H2 0.0076
Further Details:      
 
Domain Number 7 Region: 97-141
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.00000000000863
Family KRAB domain (Kruppel-associated box) 0.002
Further Details:      
 
Domain Number 8 Region: 281-333
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000127
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 9 Region: 39-79
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0000000000327
Family KRAB domain (Kruppel-associated box) 0.002
Further Details:      
 
Domain Number 10 Region: 487-542
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000217
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 11 Region: 431-487
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000127
Family Classic zinc finger, C2H2 0.018
Further Details:      
 
Domain Number 12 Region: 215-260
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000032
Family Classic zinc finger, C2H2 0.037
Further Details:      
 
Weak hits

Sequence:  HGL_H00000376616
Domain Number - Region: 7-42
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0531
Family Rhodopsin-like 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000376616
Sequence length 771
Comment ZNF425 (Homo_sapiens) zinc finger protein 425
Sequence
MTEMASGDPVIDKEVLILIIILFLLCLVAVMGNGFVVVTITFDDVALYFLEQEWEILEMW
QKEIYAQVMKANYEALDFLAGDYAASREAVMAEPASVTITFDDVALYFLEQEWEILEMWQ
KEIYAQVMKANYEALDFLDAQGTLRTKGEECHLNGLHNQDLCANLFGKEPEGLSDQRANF
QSPRLQETEIINKKLHTSALNQDKKNPWCKPMSAAGHLEIHPEPRSYSCFVCREAFQMKS
ILVKHRKSHSKNQPRKCAKCTSKPRGQSEHRRTPMFPQRKKPFQCSEFRQSYYLRCSLAT
HQAVHTGQQPFPCPNYGKAFQYKANLRKHLHLHSRQKLFCCGECGKGFAQQCKLTEHLCQ
HSGKKPFCCSECGRYFTRKAALKTHQRMHSGEKQFDCDDCGRKFIYKTKLTEHVRGHTGE
KPFPCPECYKSFRLQRRLIAHQSQDRGKQPFQCLECAQSCFWRNAMRPHQCLHREEKPFC
RDCGKRFTRSSKLACHAGVHTWQKEFPCTQCTKTFPWHSRPTQHLKIHAAEKPFCTTCGQ
SFRGHWHLLEHTWLHSKARPFWCPECNKSFSWKASMKSHQHTQRGEKPFECGDCGKSYAQ
QSQLTEHLRVHSGEKPYQCPQCDRSFRLKGNLKSHLFQHSSKKPFSCNKCGKSFTHQYRL
TEHSRVHSGEKPFQCPECDKSYCIRGSLKVHLYTHNGEKPFQCPECGKGFLQKRSLTAHL
QQHSGERPFSCGECGRSFTYMGALNTHLTVHAREKPLQSPSQATQSGGDSC
Download sequence
Identical sequences G5BES9
HGL_H00000376616

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]