SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000376636-2 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  HGL_H00000376636-2
Domain Number - Region: 97-186
Classification Level Classification E-value
Superfamily Tropomyosin 0.000324
Family Tropomyosin 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000376636-2
Sequence length 246
Comment KIAA1598 (Homo_sapiens) KIAA1598
Sequence
MVTEEVSFMQNHLEIEKICQENAKALATKLNKENKTLKRISMLSMAKLGPDVITEEISID
DEDATTDIDGAAETCISVQCQKQINELQDQISTVPDQQLLKALDENAKLIQQLEEERIQH
QQKVKELEKQLENEALHKEIHNLKQQLELLEENKKELELKYQNSEEKARNLKHSIDELQK
RVNQSKNSVLPPPPPPPPLPPPPPNPIRSLISMIWKRSHPSGSGAKKEKAIQPETTEEVT
DLEASC
Download sequence
Identical sequences G5AS34
HGL_H00000376636-2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]