SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000376923 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  HGL_H00000376923
Domain Number - Region: 275-371
Classification Level Classification E-value
Superfamily Formate dehydrogenase/DMSO reductase, domains 1-3 0.00245
Family Formate dehydrogenase/DMSO reductase, domains 1-3 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000376923
Sequence length 547
Comment NRF1 (Homo_sapiens) nuclear respiratory factor 1
Sequence
MLKQIMEQSTGETSPDPCTHWVPCTWIFMEEHGVTQTEHMATIEAHAVAQQVQQVHVATY
TEHSMLSADEDSPSSPEDTSYDDSDILNSTAADEVTAHLAAAGPVGMAAAAAVATGKKRK
RPHVFESNPSIRKRQQTRLLRKLRATLDEYTTRVGQQAIVLCISPSKPNPVFKVFGAAPL
ENVVRKYKSMILEDLESALAEHAPAPQEVNSELPPLTIDGIPVSVDKMTQAQLRAFIPEM
LKYSTGRGKPGWGKESCKPIWWPEDIPWANVRSDVRTEEQKQRVSWTQALRTIVKNCYKQ
HGREDLLYAFEDQQTQTQATTTHSIAHLVPSQTVVQTFSNPDGTVSLIQVGTGATVATLA
DASELPTTVTVAQVNYSAVADGEVEQNWATLQGGEMTIQTTQASEATQAVASLAEAAVAA
SQEMQQGATVTMALNSEAAAHAVATLAEATLQGGGQIVLSGETAAAVGALTGVQDANGYT
FTPVGQGRSVPMTAEETLLLVGGRFELPPEKCHHTPVPRVKAAGCDEGAFLLFDFLDIGE
YPDKQKG
Download sequence
Identical sequences G5BH83
HGL_H00000376923

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]