SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000376966-2 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000376966-2
Domain Number 1 Region: 16-262
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 9.29e-55
Family Voltage-gated potassium channels 0.00083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000376966-2
Sequence length 424
Comment KCNC2 (Homo_sapiens) potassium voltage-gated channel, Shaw-related subfamily, member 2
Sequence
MAMKRIRKIKVKRLKFIAFASLFFILVSITTFCLETHEAFNIVKNKTEPVINGTSVVLQY
EIETDPALTYVEGVCVVWFTFEFLVRIVFSPNKLEFIKNLLNIIDFVAILPFYLEVGLSG
LSSKAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVL
IFATMIYYAERVGAQPNDPSASEHTQFKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVG
ALCALAGVLTIAMPVPVIVNNFGMYYSLAMAKQKLPRKRKKHIPPAPQTSSPTFCKTELN
MACNSTQSDTCLGKDNRLLEHNRSVLSGDDSTGSEPPLSPPERLSIRRSSTRDKNRRGET
CFLLTTGAYTCASDEGIRKGYEKSRSLNNIAGLAGNALRLSPVTSPYSSPCPLRRSRSPI
PSIL
Download sequence
Identical sequences G5AXD8
HGL_H00000376966-2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]