SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000377046 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000377046
Domain Number 1 Region: 1733-2036
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.9e-101
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.000000388
Further Details:      
 
Domain Number 2 Region: 67-330
Classification Level Classification E-value
Superfamily Carbonic anhydrase 7.07e-75
Family Carbonic anhydrase 0.00000786
Further Details:      
 
Domain Number 3 Region: 2034-2319
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 3.83e-71
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.000014
Further Details:      
 
Domain Number 4 Region: 339-438
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000459
Family Fibronectin type III 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000377046
Sequence length 2352
Comment PTPRZ1 (Homo_sapiens) protein tyrosine phosphatase, receptor-type, Z polypeptide 1
Sequence
MTCTDPGELNTPRVFGPLLASSCCPVCSSAETFGPFRVALFAVLLMSTKDWAYGYYRQQR
KLVEEIGWSYTGALNQKNWGKKYPTCNSPKQSPINIDEDLTQVNVNLKKLKFQGWDKASL
ENTFIHNTGKTVEINITNDYRLSGGLSEMVFKASKITFHWGKCNMSSDGSEHSLEGQKYP
LEMQIYCFDMDRFSSFEEAIKGKGRLRALSILFEVGIEENLDYKAIIDGVESVSRFGKQA
ALDPFTLLNLLPNSTDKYYIYNGSLTSPPCTDTVEWIVFKDTVSISESQLAVFCEVLTMQ
QSGYVMLMDYLQNNFREQQYKFSRQVFSSYTGKEEIHEAVCSSEPENVQADPENYTSLLV
TWGRPRVVYETMIEKFAVVYQQLEGEDQTKHEFLTDGYQDLGAILNNLLPNMSYVLQIVA
ICTNGLYGKYSDQLIVDMPTSDAELDFFPELIGAEEIIKEEKEKDIEEDTVVNPGRDSAT
NQIRKKEPPGSTTTHSSRLGSRYNETKTNRSPTRGGDFSGKGALPNTSLNSTPLPGPELV
TAKEIFLFSQTELPPHTVEGTSSSLNDGSKTILRFPQMNFSGTVESLNPASITEYPEIST
DMSEEDNLLTDFTLDTGADDSSGSSPATSAMPFILENISNGYIFSSENPEAITYDVLKPG
TTRNTSEESASSGSEESLRDLSIDRSVWFPSSTDVTTQPDTGSGKEIFLQTNYTEIHTDK
SEKGTESLSPGPMGSQGPSVTDMEMPHYSTLAYFPTEVTPRAFTSSSGQHGSARTISVVQ
SQTTQPVYNGETPLQPSYSSEVFPLVTPLLLDNQILNTTLAASSSDSALHATPIFPNVDV
SFESTLSSYDGAPLLPFSSASFSSELFHHLHTGSQILPQVPAATESDRVSLHASLPVAGG
DVLLEPSLAQHSDVVSHQPSTHAASETLEFGSESGVLYKTRMLSQVEPSSSDVMMHAHSS
GPEPSFALSNNESSQRIFAVPYSSAIPVHDSVDVSYQGSIFSSPSHVSVPKSSLIAPTAS
LLQPTYALSGDEEWSGASSDREFILPDTDGLTALNISSPVSVDEFTYATSVFGDDTKLLS
KSEIIYGNETELKISSLSEMAYHSESTVLPNMYDNVNKLNASLQETSAFISSTEGMHPGS
LVYTATKAFDHEISQVPENNFPVQPTHTVSQSFGDTSLKFVPSASSEPASSDPASSEMLP
PSTQLLFHEASSPFNPEVLLQPSFQPSDGDTLLKTVLPAVPSDPLLVETPKVDKISSTIL
HLMASHSAESENMLHSTSVPVFDVLASNMQSAAFQGLTVSYTSEKYFEPVLLTSKSSQQV
VPSLYSNDELFQTANLEINQVFPQKGRDVFATPILSIDEPPNTFTNKLTNSDEVFTSPKS
SNTDEVLAGIPTVVSHTIVSTNHSASLESGYISTTAVPPKRDGSVTTGKLLIPSKATSKL
TDSARSEVDLVGGGEDGGNYDYYDDDYDKDGDGLSMNKCMSCSSYRESQEKVTNDSDAQE
NNFVDHNNPVLDSLSENSEEENALTGAISDSQIGVDRNLDKSPPTNVLTQKHNDGKGDLG
IHTGSALLPLAPESKAWAVLTSDEESGSGQGTSGSLNDNETSTDFSFPGVNERDSDGVLE
AGDSEITPGSPRSSTPSGTSEHSEVFSNSEAEASNSSHESRIGLAEGLESEKKAVIPLVI
VSALTFICLVVLVGILIYWRKCFQTAHFYLEDSTSPRVISTPPTPIFPISDDVGAIPIKH
FPKHVADLHASNGFTEEFETLKEFYQEVQSCTVNLGITADSSNHPDNKHKNRYVNIVAYD
HSRVKLAQLAEKDGKLTDYINANYVDGYNRPKAYIAAQGPLKSTAEDFWRMIWEHNVEVI
IMITNLVEKGRRKCDQYWPTDGSEEYGNFLVNQKNVRVFGYYTVRNFTLRNTKIKKGSQK
GRPSGRVVTQYHYTQWPDMGVPEYSLPVLTFVRKAAHAKRHAVGPVVVHCSAGVGRTGTY
IVLDSMLQQIQHEGTVNVFGFLKHIRSQRNYLVQTEEQYVFIHDTLVEAILSKETEVPDS
HIHAYVNALLIPGPTGKMKLEKQFQLLSQSNIQQSDYSTALKQCNREKNRTSSIIPVERS
RVGISSLTGEGTDYINASYVMGYYQSNEFIITQHPLLHTIKDFWRMIWDHNAQLVVMIPD
GQNMAEDEFVYWPNKDEPINCESFKVTLMAEEQKCLSNEEKLIIQDFILEATQDDYVLEV
RHFQCPKWPNPDSPISKTFELISIIKEEAANRDGPMIVHDEHGGVTAGTFCALTTLMHQL
EKENSVDVYQVSKMINLMRPGVFADIEQYQFLYKVVLSLVSTRQEENPSTSLDSNGAALP
DGNMAESLESLV
Download sequence
Identical sequences G5AZE3
HGL_H00000377046

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]