SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000377571-1 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000377571-1
Domain Number 1 Region: 3-116
Classification Level Classification E-value
Superfamily Cap-Gly domain 9.95e-34
Family Cap-Gly domain 0.00000234
Further Details:      
 
Weak hits

Sequence:  HGL_H00000377571-1
Domain Number - Region: 930-1033
Classification Level Classification E-value
Superfamily Tropomyosin 0.00203
Family Tropomyosin 0.0061
Further Details:      
 
Domain Number - Region: 1212-1315
Classification Level Classification E-value
Superfamily Tropomyosin 0.00203
Family Tropomyosin 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000377571-1
Sequence length 1545
Comment DCTN1 (Homo_sapiens) dynactin 1
Sequence
MAQSKRHVYNRTPSSSRMSAEASARPLRVGSRVEVIGKGHRGTVAYVGATLFATGKWVGV
ILDEAKGKNDGVVQGRKYFTCDEGHGIFVRQSQIQVFEDGADTTSPETPDSSASKVLKRE
GADTAAKTSKLTTTRRPKPTRPASTGVSGASSSLGPSGSASAGELSSSEPSTPAQTPLAA
PIIPTPVLTSPGAAPPLPSPSKEEEGLRAQVRDLEEKLETLRLKRAEDKAKLKELEKHKI
QLEQVQEWKSKMQEQQADLQRRLKEARKEAKEAMEAKERYMEEMADTADAIEMATLDKEM
AEERAESLQQEVEALKERVDELTTDLEILKAEIEEKGSDGAASSYQLKQLEEQNARLKDA
LVRMRDLSSSEKQEHVKLQKLMEKKNQELEVVRQQRERLQEELTQAESTIDELKEQVDAA
LGAEEMVEMLTDRNLNLEEKVRELRETVGDLEAMNEMNDELQENARETELELREQLDMAG
ARVREAQKRVEAAQETVADYQQTIKKYRQLTAHLQDVNRELTNQQEASVERQQQPPLETF
DFKIKFAETKAHAKAIEMELRQMEVAQANRHMSLLTAFMPDSFLRPGGDHDCVLVLLLMP
RLICKAELIRKQAQEKFELSENSLERPGLRGAAGEQLSFAAGLVYSLSLLQATLHRYEHA
LSQCNVDVYKKVGSLYPEMSAHERSLDFLIELLHKDQLDETVNVEPLTKAIKYYQHLYSI
HLAEQPEDCTMQLADHIKFTQSALDCMSVEVGRLRAFLQSGQEATDLALLLRDLETSCSD
IRQFCKKIRRRMPGTDAPGIPAALAFGSQVSDTLLDCRKHLTWVVAVLQEVAAAAAQLIA
PLAENEGLPVAALEELAFKANEQIYGSPSSSPYECLRQSCTILISTMNKLATAMQEGEYD
AERPPSKPPPVELRAAALRAEITDAEGLGLKLEDRETVIKELKKSLKIKGEELSEANVRL
SLLEKKLDSAAKDADERIDKVQTRLEETQTLLRKKEKEFEETMDALQADIDQLEAEKAEL
KQRLNNQSKRTIEGLRGAPPSGIATLVSGIAVRGTPGQAPGSLPGPGLVKDSPLLLQQIS
AMRLHISQLQHENSILKGAQMKASLAALPPLHVAKLSLPPHEGPAKNEGLPVAALEELAF
KANEQIYGSPSSSPYECLRQSCTILISTMNKLATAMQEGEYDAERPPSKPPPVELRAAAL
RAEITDAEGLGLKLEDRETVIKELKKSLKIKGEELSEANVRLSLLEKKLDSAAKDADERI
DKVQTRLEETQTLLRKKEKEFEETMDALQADIDQLEAEKAELKQRLNNQSKRTIEGLRGA
PPSGIATLVSGIAGGSTPGQAPGSLPGPGLVKDSPLLLQQISAMRLHISQLQHENSILKG
AQMKASLAALPPLHVAKLSLPPHEGPASELAAGVLYRKTSQLLETLNQLSTHTHVVDITR
ASPASKSPSAQLMEQVAQLKSLSDTIEKLKDEVLRETVSQRPGATVPTDFATFPSSVFLR
AKEEQQDDTVYMGKVTFSCAAGLGQRHRLVLTQEQLYQLHSHLIS
Download sequence
Identical sequences G5AXG2
HGL_H00000377571-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]