SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000377612 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000377612
Domain Number 1 Region: 645-764
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.64e-31
Family PLC-like (P variant) 0.04
Further Details:      
 
Domain Number 2 Region: 957-1089
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 4.13e-27
Family Synaptotagmin-like (S variant) 0.0019
Further Details:      
 
Domain Number 3 Region: 322-446
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 9.35e-27
Family PLC-like (P variant) 0.02
Further Details:      
 
Domain Number 4 Region: 476-604
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.28e-23
Family Synaptotagmin-like (S variant) 0.042
Further Details:      
 
Domain Number 5 Region: 796-907
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.71e-20
Family Synaptotagmin-like (S variant) 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000377612
Sequence length 1093
Comment ESYT1 (Homo_sapiens) extended synaptotagmin-like protein 1
Sequence
MERSPGEGPSPVDQPSAPSDPPDPPTAHTKLDPDSGVPPGGPGAGSEALAVLTSFVRRLL
VLVPVYLAGAAGLSVGFVVFGLALYLGWRRVRDEKERSLRAARQLLDDEERLTAKTLYLS
HRELPAWVSFPDVEKAEWLNKIVAQVWPFLGQYMEKLLAETVAPAVRGSNPHLQTFTFTR
VELGEKPLRIIGVKVHPSQRKDQILLDLNVSYVGDVQIDVEIKKYFCKAGVKGMQLHGIL
RVILEPLMGDLPIVGAVSMFFIRRPTLDINWTGMTNLLDIPGLSSLSDTMIMDSIAAFLV
LPNRLLVPLVPNLHDVAQLRSPLPRGIIRIHLLAAQGLSSKDKYVKGLIEGKSDPYALVR
VGTQTFCSCVINEELSPQWGETYEVMVHEVPGQEIEVEVFDKDPDKDDFLGRMKLDVGKV
LQAGVLDDWYPLQGGKGQVHLRLEWLSLLPDAEKLEHVLQWNKGVSSQPEPPSAAILVVY
LDRAQDLPLKKGNKEPNPMVQLSIQDVTQESKAVYGTNSPVWEEAFRFFLQDPRSQELDV
QVKDDSRALTLGALTLPLARLLTASELTLDQWFQLSGSGPNSRLYMKLVMRILYLDSSQI
CFPAVPGTTTAWDPDSESPATGSSVDAPPRPCHTTPASHFGTENVLRIHILEAQDLIAKD
RFLGGLVKGKSDPYVKLKLAGRSFRSRVVREDLNPRWNEVFEVIVTSVPGQELEVEVFDK
DLDKDDFLGRCKVSLTTVLNSGFLDEWLTLEDVLSGRLHLRLERLSPRPTAADLEEVLQV
NSLIQTQKSAELASALLSVYLERAEDLPLRKGTKPPSPYATLTVGETSHKTKTVSHSSAP
VWDESASFLIRKPHTESLELQVRGEGTGTLGSLSLPFSELLEADRLCLDRWFVLTNGQGQ
VLLKAQLGILVSQHSGVEAHSHSHSSSSLTEEAESSTSSAPELRQRLVHGDSPLQAPVGP
LGQVKLTVWYYSEERKLVSIVHGCRALRQNGRDPPDPYVSLLLLPDKNRGTKRKTSLKKR
TLNPEFSERFEWELPMDEVLRRKLDVSVKSSSSFMSRERELLGKVQLDLAEIDLSQGAAQ
WYDLMDDKDKGSS
Download sequence
Identical sequences G5BB87
XP_004861398.1.39548 HGL_H00000377612

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]