SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000377665 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000377665
Domain Number 1 Region: 1303-1476
Classification Level Classification E-value
Superfamily VPS9 domain 1.12e-35
Family VPS9 domain 0.00087
Further Details:      
 
Domain Number 2 Region: 1479-1585
Classification Level Classification E-value
Superfamily VPS9 domain 2.48e-35
Family VPS9 domain 0.00033
Further Details:      
 
Domain Number 3 Region: 289-504
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 0.00000000000000706
Family p120GAP domain-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000377665
Sequence length 1588
Comment GAPVD1 (Homo_sapiens) GTPase activating protein and VPS9 domains 1
Sequence
MLENVVNPILVSEGPYRLRWVLAERDRTLKHTANRTRTGSQGDCCFRTTSPRGPRGAAQA
RWPGGRAAARHSKADQRAATAVAVSGEGDGSEADLLSDWDLGAFFRMRPSCLAFVPFPHL
KMVKLDIHTLAHHLKQERLYVNSEKQLIQRLNADVLKTAEKLYRTAWIAKQQRINLDRLI
ITSVKCLAFVPFPHLKMVKLDIHTLAHHLKQERLYVNSEKQLIQRLNADVLKTAEKLYRT
AWIAKQQRINLDRLIITSAEASPAECCQHAKILEDTQFVDGYKQLGFQETAYGEFLSRLR
ENPRLIASSLVAGEKLNQENTQSVIYTVFTSLYGNCIMQEDESYLLQVLRYLIEFELKES
DNPRRLLRRGTCAFIVNPEQYGIISDAPINEVARFNLMQVGRLLQQLAMTGSEEGDPRTK
SSLGKFDKSCVAAFLDVVIGGRAVETPPMSSVNLLEGLSRTVVYITYSQLLTLVNFMKSV
MSGDQLREDRMALDNLLANLPQARPGKSSSLEMTPYNTPQLSPATTPANKKNRLPIATRS
RSRTNMLMDLHMDHEGSSQETIQEVQPEEVLVISLGTSPQLTPGMMSENEVLNMQLVDGG
QGDVPVDENKLHGKPDKTLRFSLCSDNLEGISEGPSNRSNSVSSLDLEGESVSELGAGPS
GSNGVEALQLLEHEQATTQDNLDDKLRKFEIRDMMGLTDDRDISETVSETWSTDVLGSDF
DPNIDEDRLQEIAGAAAENMLGSLLCLPGSGSVLLDPCTGSTISETTSEAWSVEVLPSDS
EAPDLKQEERLQELESCSGLGSTSDDTDVREVSSRPSTPGLSVVSGISATSEDIPNKIED
LRSECSSDFGGKDSVTSPDMDEITHGAHQLTSPPSQSESLLAMFDPLSSHEGASAVVRPK
VHYARPSHPPPDPPILEGAVGGNEARLPNFGSHVLTPAEMEAFKQRHSYPERLVRSRSSD
IVSSVRRPMSDPSWNRRPGTEERELPQAAAIGATSLVAAPHSSSSSPSKDSSRGETEDRK
DSDDEKSDRNRPWWRKRFVSAMPKAPIPFRKKEKQEKDKDDLGPDRFSTLTDDPSPRLST
QAQVAEDILDKYRNAIKRSSPSDGAMANYESAEIMGDGESAHDSPRDETLQNISADDLPD
SASQAAHPQDSAFSYRDAKKKLRLALCSADSVAFPVLTHSTRNGLPDHTDPEGKLLQFNN
EIVCFLKVQIAEAINLQDKNLMAQLQETMRCVCRFDNRTCRKLLASIAEDYRKRAPYIAY
LTRCRQGLQTTQAHLERLLQRVLRDKEVANRYFTTVCVRLLLESKEKKIREFIQDFQKLT
AADDKTAQVEDFLQFLYGAMAQDVIWQNASEEQLQDAQLAIERSVMNRIFKLAFYPNQDG
DILRDQVLHEHIQRLSKVVTANHRALQIPEVYLREAPWPSAQSEIRTISAYKTPRDKVQC
ILRMCSTIMNLLSLANEDSVPGADDFVPVLVFVLIKVYLREAPWPSAQSEIRTISAYKTP
RDKVQCILRMCSTIMNLLSLANEDSVPGADDFVPVLVFVLIKANPPCLLSTVQYISSFYS
SCLSGEESYWWMQFTAAVEFIKTIDDRK
Download sequence
Identical sequences G5B6V6
HGL_H00000377665

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]