SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000377694 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000377694
Domain Number 1 Region: 667-749
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000000000258
Family Canonical RBD 0.005
Further Details:      
 
Domain Number 2 Region: 992-1075
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000000172
Family Canonical RBD 0.0037
Further Details:      
 
Domain Number 3 Region: 1901-1955
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000357
Family HkH motif-containing C2H2 finger 0.044
Further Details:      
 
Domain Number 4 Region: 893-973
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.000000019
Family Canonical RBD 0.0031
Further Details:      
 
Weak hits

Sequence:  HGL_H00000377694
Domain Number - Region: 423-461
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00155
Family Classic zinc finger, C2H2 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000377694
Sequence length 1961
Comment ZNF638 (Homo_sapiens) zinc finger protein 638
Sequence
MSRPRFNPRGNFPLQRPRAPNPSGMRPPGPFMRPGSMGLPRFYPAGRARGIPHRFAGHES
YQNMGPQRMNVQVTQHRTDPRLTKEKLDFHEAEKKGKPHGSRWDDEPHISASVGVKQSSI
TQVTEQSPKVQSRYTKESASSILASFGLSNEDLEELSRYPDEQLTPENMPLILRDIRMRK
MGRRLPNLPSQSRNKETLGSEAVSSNVIDYGHASKYGYTEDPLEVRIYDPEIPTDEVKNE
FRSQQSISASVPTPNVICNPVFPVEDMFRQMDFPSESSNNQSFFPVESGTKMSGLHITGQ
SVLEPVKSISQSINQAVSQTMSQSLIPPSMNQPPFSSELISGVSQQERIPHKPVINSSDV
HVGSRGSKKTYQSETDIPIQSPFGIVKASWLPKFSHADAQKMKRLPTPSMMNDYYAASPR
IFPHLCSLCNVECSHLKDWIQHQNTSTHIESCRQLRQQYPDWNPEILPSRRNEGNRKENE
TPRRRSHSPSPRHSRRSSSRHRFHRSRSPIRYTYRPRSRSPKICHRFISRFRSRSRSRSP
YRIRNPFRGSPRCYRSVSPERTSRRSVRSSDRKKALEDVVQRSGHGAEFNKQKHLEAVDK
GHSPAQKPKIVSGTKPSVKSTTSTKSDTNLGGHSTRKSKNLEDDSLSESKQVSDKAVSLQ
RKFRKEQSLRYGSVLLVSELPEDGCTEEDIRKVFQPFGKVADILIVPYRKEAYLEMEFKA
VTAVIKNTDTVPLLIKGKSVKVSVPGKKKVQNKEMKKKTSDTKKLSTAALKKDTDASKTV
ETVTSTSTAKAGQAKTSTAKVNKSAGKSAGSVKSVVTVAAKGKAVKTAKSTGKKSLESKK
VGNVKNKDSSKPVTLPANSEIKTSLEVQASENSAKETISGKEILKLIFKFLLKETEEMCV
ILISNLPNRGYSTEEICNLAKPFGGLKDILILSSHKKAFIEINRKSAESMVKFYTCFPIS
MDGNQLSISVAPENMNIKDEEALFMTLIKENDPEANTNKIYNRFVHLYNLPEDGLQCVLC
VGLQFGKVDHHIFMNNKNKAILQLESPESAQSMYNFLKRHPQNIGDHVLICTLSSKIDSS
EVQTEKEPELKESPGLKNSPVDESEVQTAADSPSVKPSKVEEETTPTIQTETLVQQEEPC
EEEPEKVLCDSDFAIETFEIETQAEEIKIELPLVASIPASTELFTENIEECALNQQVYSS
DFEKEEAEIMNPETELSTSDSAFVEEKNVKGILEEPPSKAEDFFAGITQSMAEAVAEVDK
HETVSEIVPSACVVTVVPDDTGDEKAVSKKNISEKNNMDEKAENQFNTKETRMDLQIGTE
KTEKNEARMVAEKLEKIMAAVKEKPAENVIKTYPNKRASQTSKPDETGKTSMLAGSNVSS
SKSSIKVTMVPSKAKATASKSENQKSFLKSVLTDQINAEKKLSAKEFGLFKSARSGLAES
NSKFKPTQSGVTRGGSGRISALQGKDSKLDYKDITKQSQETEARPSIKRDDSNNKALAGQ
NTKNSKSTTGRSSKSKEEPLFSFNLDEFVTVDEVIEEVNPSQAKQNPLKGKRKEALRNTP
PSELNLKKKKGKTSAPRSVEGELSFVTLDEIGEEEDADAQALVTVDEVIDEEELNMEEMV
KNSNSLLTLDELIDHEDCISHSEPKDVTVLSVAEEQDLLKQERLVTVDEIGEVEELPLNE
SADITFATLNDKGDEGNTVRNSIGFISSQMPEDPSTLVTVDEIQDDGSDLHLVTLDEVTE
EDEDSLADFNNLKEELNFVTVDEVGEEEDGDNDLKVELAQSKNDHPTDKKGDRKKRAVDT
QKTKLETLSHVGLVNENVMEEDLKTTIERHLAAKTPVKRVRMGKTPPSEKVVATEPAKGE
EAFQISEANESELKDSEPDRKRKKIEDASLDKSVTPDVPEDLDFLVPKAGFFCPICSLFY
SGEKAMTNHCKSTRHKQNTEKFMAKQRKEKEQNEAEERSSR
Download sequence
Identical sequences G5AW45
HGL_H00000377694

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]