SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000377701 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000377701
Domain Number 1 Region: 435-673,706-773
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 1.55e-51
Family Diacylglycerol kinase-like 0.025
Further Details:      
 
Domain Number 2 Region: 61-177
Classification Level Classification E-value
Superfamily EF-hand 7.49e-44
Family EF-hand modules in multidomain proteins 0.00000481
Further Details:      
 
Domain Number 3 Region: 146-242
Classification Level Classification E-value
Superfamily EF-hand 1.2e-17
Family Calmodulin-like 0.019
Further Details:      
 
Domain Number 4 Region: 245-312
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000000284
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.012
Further Details:      
 
Domain Number 5 Region: 315-383
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000000867
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000377701
Sequence length 794
Comment DGKA (Homo_sapiens) diacylglycerol kinase, alpha 80kDa
Sequence
MAPSPEPSSLRQRSSVAPRRGGAGWGPSQTWFYAFPLKKTKRRKYYYQAAFVAILKKNRK
MAKERGLISPEDFVQLQKYMEYSTQKVSDVLKLFEDGEMAKYLQGDAIGYEGFEQFLKIY
LEVDDVPSHLSSALFQSFHNGQCLNETLLKDVVCLSDVSCYFSLLEGGRPEDKLEFTFKL
YDTDRNGILDSSEVEKIILQMMRVAEYLDWDVSELRPILQEMMKEIDYDGSGSVSLAEWV
RAGATMVPLLVLLGLEMTLKDDGQHMWRPKRFPRPVYCNLCESSIGLGKQGLSCNLCKYT
VHDHCAMKAAPCEVSTYAKSRKDIGVQSHVWVRGGCESGRCDRCQKKIRIYHSLTGLHCV
WCHLQIHDDCLEAVGPECDCGLLREHILPPSSIYPSVLASGQERKQSKRSQKSMDDLNVF
TSEALRIEPVPNTHPLLVFVNPKSGGKQGQRVLWKFQYILNPRQVFNLLQDGPEPGLRFF
KDVPDSRILVCGGDGTVGWILESIEKANLPVVPPVAVLPLGTGNDLARCLRWGGGYEGQN
LAKILKDLEMSKVVHIDRWSLEVIPQQTEEKSDPVPFQIINNYFSIGVDASIAHRFHIMR
EKYPEKFNSRMKNKLWYFEFATSESIFSTCKKLEESLTVEICGKPLDLSNLSLEGIAVLN
IPSMHGGSNLWGDAKRPHGDICGINQALGSTAKVITDPDILKTCVPDLSDKRLEVVGLEG
AIEMGQIYTKLKSAGRRLAKCSEITFHTTKTLPMQIDGEPWMQSPCTIKITHKNQMPMLM
GPPPRSSNFFGFLG
Download sequence
Identical sequences G5BB97
HGL_H00000377701

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]