SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000377725 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000377725
Domain Number 1 Region: 243-299
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.8e-24
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 2 Region: 473-530
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.09e-23
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 3 Region: 432-483
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.85e-19
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 4 Region: 659-711
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.69e-18
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 5 Region: 288-340
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.15e-17
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 6 Region: 586-639
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000207
Family Classic zinc finger, C2H2 0.0076
Further Details:      
 
Domain Number 7 Region: 105-156
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0000000000000392
Family KRAB domain (Kruppel-associated box) 0.002
Further Details:      
 
Domain Number 8 Region: 530-585
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000215
Family Classic zinc finger, C2H2 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000377725
Sequence length 722
Comment ZKSCAN5 (Homo_sapiens) zinc finger with KRAB and SCAN domains 5
Sequence
MVSPGAVQETFGHQFLSMDAQPEQEPRKPHVLEENALPVLQAPSLPLKDSQELTASLPSA
GSQVSWYLFGLCEDLHPFSDRFDHREWEFSRDLLFQKLVKIEDVADMAVSFILEEWEHLD
QSQKSLYRDGRKENYGSITSLDYESKDNNMELTAKQISNEASSPNSHWVAVGSTERNISQ
SQEFAEVSDFKGMVQRWQVNPTMGKLKQNPSQKRDLSTSKDTNRKQSTNGERGHRCNDCG
KFFLQASNFIQHRRIHTGEKPFQCGECGKSYNQRVHLTQHQRVHTGEKPYKCQVCGKAFR
VSSHLVQHHSVHSGERPYGCNECGKSFGRHSHLIEHLKRHFREKSQICSDRRSRNTKLNV
KNKISEFSEADMEVPEKIQRNASEVQGFQEGYEHQGKADRKQGLPMKEILGQPSSKRINC
SEVTYIHKKPSTGERPHKCNECGKSFIQSAHLVQHQRIHTGEKPFRCDECGKSYNQRVHL
TQHQRVHTGEKPYTCHLCGKAFRVRSHLVQHQSVHSGERPFKCNECGKGFGRRSHLAGHL
RLHSREKSHQCHECGEIFFQYVSLIEHQVLHVGQKNEKNGICEEAYSWNLTVIEDKKIEL
QEQPYKCDICGRAFNYSSDLIQHYRTHTAEKTHKCDICRGNIGQCSHIKQHQKICPSAKP
HQCNECGRGFTLKSHLSQHQRIHTGEKPFQCKECGMSFSWSCSLFKHLRSHERTDTINTL
CA
Download sequence
Identical sequences G5AX96
HGL_H00000377725

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]