SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000377840 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000377840
Domain Number 1 Region: 223-408
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.98e-49
Family Nucleotide and nucleoside kinases 0.0000000285
Further Details:      
 
Domain Number 2 Region: 55-222
Classification Level Classification E-value
Superfamily SH3-domain 2.1e-37
Family SH3-domain 0.00000859
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000377840
Sequence length 652
Comment CACNB1 (Homo_sapiens) calcium channel, voltage-dependent, beta 1 subunit
Sequence
MGGKYSKRKGRFKRSDGSTSSDTTSNSFVRQGSAESYTSRPSDSDVSLEEDREALRKEAE
RQALAQLEKAKTKPVAFAVRTNVGYNPSPGDEVPVQGVAITFEPKDFLHIKEKYNNDWWI
GRLVKEGCEVGFIPSPVKLDSLRLLQEQKLRQNRLSSSKSGNEVTNLAFELDPLELEEDE
VELGGQDGSAKTSVSSVTTPPPHGKRIPFFKKTDHVPPYDVVPSMRPIILVGPSLKGYEV
TDMMQKALFDFLKHRFDGRISITRVTADISLAKRSVLNNPSKHVIIERSNTRSSLAEVQS
EIERIFELARTLQLVALDADTINHPAQLFKTSLAPITVYIKITSPKVLQRLIKSRGKSQS
KHLNVQIAASEKLAQCPPEMFDIILDENQLEDACEHLAEYLEAYWKATHPXNPLLTRTMA
TAALAASPAPVSNLQGPYLASGDQPLERATGEHASVREYPGEPGQPPGRHAPSRAGXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
AREGGRGSHLAASPPGPLSPPFRCLCSVLGISGVPAGSRAPLKPQLWGFLTC
Download sequence
Identical sequences G5BRW2
HGL_H00000377840

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]