SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000378056 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000378056
Domain Number 1 Region: 411-745
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 5.32e-109
Family PDEase 0.00000153
Further Details:      
 
Domain Number 2 Region: 152-252
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000000279
Family Heme-binding PAS domain 0.019
Further Details:      
 
Domain Number 3 Region: 20-97
Classification Level Classification E-value
Superfamily CheY-like 0.0000896
Family CheY-related 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000378056
Sequence length 755
Comment PDE8A (Homo_sapiens) phosphodiesterase 8A
Sequence
MRFHQDQLQVLLVFTKEDNQCNGFCRACEKAGFKCTVTKEAQAVLTCFLDKHHDIIIIDH
RNPGQLDAEALCRSIRSSKLSENTVIVGVVRRVDKEELSVMPFIAAGFTRRYIENPSIMA
CYNELLQLEFGEVRSQLKLRACNSVFTALEKSQEAIEITSEDHIIQYANPAFETTMGYQS
GELIGKELAEVPVNEKKADLLDTINSCVRIGKEWQGIYHAKKKNGDNIQQNVKIIPVVGQ
GGKIRHYVSIIRVCNGNSKAEKIPECVQSDIHTDNQMGKHKDRRKGSLDVKSVSSKANEV
SSQRRHSSMARIHSMTIEAPITKVMNIINTAQESSPVPVTEALDRVLQILRSTELYSPQF
GAKDDDPHANDLVGGLMSDGLRRLSGNEYVLSTKTLHPVSGTIPVSLHDVPPRVAWAMEN
AEHWDFDIFELEAATHNRPLTYLGLKMFAHFGICEFLNCSESTLKSWLQIIEANYHSSNP
YHNSTHSADVLHATAYFLSRERIKETLDPIDEAAALIAATIHDVDHPGRTNSFLCNSGSE
LALLYNDLAVLESHHVALAFQLTMGNDRCNIFKNMDRNDYRVLRQSIIDMVLATEMTKHF
EHVNKFINSVNKPLAALEENEETDNEEEAIHTLLRAPENRMLIKRMLIKCADVSNPCRPL
QQCIEWAARISEEYFSQTDEEKRKELPVVMPVFDRNTCSIPKSQISFIDYFITDMFDAWD
AFVDLPDLMQHLDNNFKYWKGLDERKLRSLRPPPE
Download sequence
Identical sequences G5B1R6
HGL_H00000378056 XP_004852902.1.39548 XP_004852903.1.39548 XP_012930557.1.39548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]