SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000378086 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000378086
Domain Number 1 Region: 508-569
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000204
Family SH3-domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000378086
Sequence length 575
Comment FUT8 (Homo_sapiens) fucosyltransferase 8 (alpha (1,6) fucosyltransferase)
Sequence
MRPWTGSWRWIMLILFAWGTLLFYIGGHLVRDNDHPDHSSRELSKILAKLERLKQQNEDL
RRMAESLRIPEGPIDQGPATGRVRVLEEQLVKAKEQIENYKKQTRNGLGKDHEVLRRRIE
NGAKELWFFLQSELKKLKNLEGNELQRHADEFLSDLGHHERSIMTDLYYLSQTDGAGDWR
EKEAKDLTELVQRRITYLQNPKDCSKAKKLVCNINKGCGYGCQLHHVVYCFMIAYGTQRT
LILESQNWRYATGGWETVFRPVSETCTDRSGVSSGHWSGEVKDKNVQVVELPIVDSLHPR
PPYLPLAVPEDLADQLLRVHGDPAVWWVSQFVKYLIRPQPWLEKEIEEATRKLGFKHPVI
GVHVRRTDKVGTEAAFHPIEEYMVHVEEHFQLLARRMQVDKKRVYLATDDPSLLKEAKTK
YPNYEFISDNSISWSAGLHNRYTENSLRGVILDIHFLSQADFLVCTFSSQVCRVAYEIMQ
TLHPDASANFHSLDDIYYFGGQNAHNQIAIYPHQPRTEEEIPMEPGDIIGVAGNHWDGYS
KGVNKKLGRTGLYPSYKVREKIETVKYPTYPEAEK
Download sequence
Identical sequences G5BD11
HGL_H00000378086 XP_004837436.1.39548 XP_004837437.1.39548 XP_004837438.1.39548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]