SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000378210 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000378210
Domain Number 1 Region: 16-332
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.46e-54
Family Ankyrin repeat 0.0000447
Further Details:      
 
Domain Number 2 Region: 417-466
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000000196
Family SOCS box-like 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000378210
Sequence length 488
Comment ASB3 (Homo_sapiens) ankyrin repeat and SOCS box-containing 3
Sequence
MDFTEAYSDTCSTVGLAVREDNVKILRKLLKKGRSIDVADNRGWMPIHEAAYHNSIECLQ
ILIHTDSSENYIKTKTFEGFCALHFAASQGHWKIAQILLEAGADPNATTLEETTPLFLGD
ENVEIIKLLLKKGADKECQDDFGITPLFLAAQYGKLESLSILISSGAKVNCQALDKATPL
FIAAQEGHTKCVKLLLSNGADPNLYCNEDSWQLPIHAAAQMGHTKILDLLIPLTNRVCET
GPDKVSPVYSAVFGGREKCLELLLQNGYSPDAQMCLVFGFSSPMCMAFQKDCEFLGIVNI
LLKYGARLNELHLAYCLKYEKFSVFRYFLKKGCPLGPWNHISEFINHAIKAQTKYKEWLP
HLLLAGFDPLTLLCSSWIDSVSEDTLIFTLEFTNWKRLPPAVEKMLSVRALNSSWVLQQW
LASVPSLSHLCRLEIRASLKTEHLKSDSFIRQLPLPRSLHNYLLYEETLRMNEVPELAVH
DGEISEAT
Download sequence
Identical sequences G5B8U5
HGL_H00000378210

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]