SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000378446 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000378446
Domain Number 1 Region: 246-347
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 5.24e-29
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0000114
Further Details:      
 
Domain Number 2 Region: 100-208
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.44e-16
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.029
Further Details:      
 
Domain Number 3 Region: 19-80
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000494
Family HLH, helix-loop-helix DNA-binding domain 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000378446
Sequence length 832
Comment HIF1A (Homo_sapiens) hypoxia inducible factor 1, alpha subunit (basic helix-loop-helix transcription factor)
Sequence
MVWRILLPPVYTLESRISSERRKEKSRDAARSRRSKESEVFYELAHQLPLPHNVSSHLDK
ASVMRLTISYLRVRKLLNTGDLDFEDEMKAQMNCFYLKALDGFVMVLTDDGDMIYISDNV
NKYMGLTQFELTGHSVFDFTHPCDHEEMKEMLTHRNGPVKKGKEQNTQRSFFLRMKCTLT
SRGRTMNIKSATWKVLHCTGHIHVYDTNNNQSQCGYKKPPMTCLVLICEPIPHPSNIEIP
LDSKTFLSRHSLDMKFSYCDERITELMGYEPEELLGRSIYEYYHALDSDHLTKTHHDMFT
KGQVTTGQYRMLAKRGGYVWVETQATVIYNTKNSQPQCIVCVNYVVSGIIQHDLIFSLQQ
TECVLKPVESSDMKITQLFTKVESEDTSSLFDKLKKEPDALTLLAPAAGDIIISLDFSSN
DTETDDQQLEEVPLYNDVMFPSSSEKLQNINLAMSPLPASESPKPLRSSADPALNQEVAL
KLEPNPESLELSFTMPQIQDQPASPSDGSTRQSSPEPNSPSDYCFDVDSDMVNVFKLELV
EKLFAEDTEAKNPFSTQDNDLDLEMLAPYIPMDDDFQLRSFDQLSPLESSSASPQSVSTT
TVFQQTQMQEPTVTTTTANTTTPPTTEELKSVTKDSMEDIQILIVSPSPTHLLKETAHAT
TSSPYSNTPSRTTSPNRAGKGAIEQTEKSHPRSPNVVPVTLSQRNTIPEEELNPKIQALQ
NAQRKRKMEHDGSLFQAVGIGTLLQQSDDRAATTSLSWKRVKGCKSSEQNGTEQKTIILI
PSDLACRLLGQSMDESGLPQLTSYDCEVNAPIQGSRNLLQGEELLRALDQVN
Download sequence
Identical sequences G5C5I4
HGL_H00000378446

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]