SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000378485 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000378485
Domain Number 1 Region: 187-388
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.91e-61
Family Protein kinases, catalytic subunit 0.000000549
Further Details:      
 
Domain Number 2 Region: 76-211
Classification Level Classification E-value
Superfamily SH2 domain 4.04e-32
Family SH2 domain 0.00000171
Further Details:      
 
Domain Number 3 Region: 11-99
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000761
Family SH3-domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000378485
Sequence length 427
Comment MATK (Homo_sapiens) megakaryocyte-associated tyrosine kinase
Sequence
MPTRRWAPGTQCITRCEHSRPKPGELAFRKGDVVTILEACENKSWYRAKHHASGQEGLLA
AGALREREALSADPKLSLMPWFHGKISGQEAVQQLQPPEDGLFLVRESARHPGDYVLCVS
FGRDVIHYRVLHRDGHLTIDEAVCFCNLMDMVEHYSKDKGPICTKLVKPKRKQGTKSAEE
ELARAGWLLHLQHLTLGSPIGEGEFGAVLQGEYLGQKVAVKNIKCDVTAQAFLDETAVMT
KLQHRNLVRLLGVILHQGLYIVMEYVSKGNLVNFLRTRGRALVNAAQLLQFSLHVAEGME
YLESKKLVHRDLAARNILVSEDLVAKVSDFGLAKAERKGLDSSRLPVKWTAPEALKHGKF
SSKSDVWSFGVLLWEVFSYGRAPYPKMLWFQNPGQVAPPRASGVRLWGGGSPEAPEASVQ
LPLEPWL
Download sequence
Identical sequences G5BBD6
HGL_H00000378485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]