SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000378782 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000378782
Domain Number 1 Region: 209-380
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase C-terminal domain-like 1.57e-49
Family NadC C-terminal domain-like 0.0000301
Further Details:      
 
Domain Number 2 Region: 104-208
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase N-terminal domain-like 6.28e-24
Family NadC N-terminal domain-like 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000378782
Sequence length 390
Comment QPRT (Homo_sapiens) quinolinate phosphoribosyltransferase
Sequence
MRPSLSGSQLLQSCRASRSRGPAGAEALAALLSGENEPGAKGVAEKTRRSFGADQPLPRT
PGLKDEASRWLRPCVKPLTRPVISAGDAKATLRGSQLARGLPLLLPPTALAALANSWLQE
DCPGLNFAALASGAFPARAALWAKSRGILAGRPFFDAVFAHLSCQISWLLPEGSRLEPVV
KVAEVRGPAHHLLLGERVALNILARCSGVASLAAAAVELTKAAGWSGQVAGTRKTTPGFR
LVEKYGLLVGGAACHRYDLGGLVMVKDNHVVAAGSVEKAVQGARLAAGFSLKVEVECGSL
QEAMQAALAGADLVMLDNFKPEELHPAATALKAQFPGVAVEASGGVTLHNLAQFCGPCVD
IISLGMLTQAAPALDFSLKLFAEEPIRPRL
Download sequence
Identical sequences G5BYM3
HGL_H00000378782

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]