SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000378871 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000378871
Domain Number 1 Region: 769-817
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000337
Family Ankyrin repeat 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000378871
Sequence length 846
Comment KANK4 (Homo_sapiens) KN motif and ankyrin repeat domains 4
Sequence
QDQPAQGDEEKDSPKSHPYSVETPYGFHLDLDFLKYVDDIEKGNTIRRVPIRRRTKQAKF
STLPRNFSLPDSSVCPQTALLQQRWSPTVPRKVFLGPQVQTQAPAPWGSTPQAWAGGSEL
SNPRKALLVEADGQWKDAALGLGSARPQLLRASSMPGTLLPSRALEGLPAPPAPPPLQDT
GGSWDGSFKPAEEPADLPSPGLGASAVETAEELGDLVLGVPEEAERPAGEVQAPDRLSPP
GPPPSFQSAPFIPEDVGVEVQTWGPQVGSTLGSSTPSPPPLPSPVPESELTLAGMELSIS
ELPLPPPPEVAVRSVGVRVTEEALGPDGSLGQQLSALQRELASRTEELAAVRAALEAREQ
RVRELQGTVAQLEEKLTQDAQARAHASVHTGPLCMDTCDKGVRAALLSPADSGHRGALGE
EGSLLRVTDSAPPGEQCPAQLALPRGPGTSPASPMYSCPAMELRIEEPAGSGQEGDAGLA
AEGTSGSDGEVALAAGEEAGPEQPGGLPGSPADAALGQYVRKIQELLQEQWSCLEHGYPE
LASALRQPASRLSSIRGQLLSSLSLLLSAYAAQGPQQEPAGHPGPSPPAPEVSPPPSLKS
IMKKKDCGFGAGGNGSKKNLQFVGVNGGYETTSSEETSAEDSSPEGLSDSEAGENGGDPE
CVRHGDAHPEQGHPEATRSTGRGSAPAEGASHPEAERCKPSEEFLHACRALSQHPPEAEA
ADPLLRQSLNTVSQEWFRVSSRKSSSPAVVAAYLLGVQPLSPHLLKLLVNLADRNGNTAL
HYSVSHSNFPIAKLLLDTGVCAVDRQNEAGYTAVMITPLASAETDEDMAVVWRLLREGNV
NIQATQ
Download sequence
Identical sequences G5BSM8
HGL_H00000378871

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]