SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000378882 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000378882
Domain Number 1 Region: 694-751
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.79e-26
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 2 Region: 470-527
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.2e-25
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 3 Region: 414-471
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.52e-23
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 4 Region: 582-639
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.82e-23
Family Classic zinc finger, C2H2 0.0061
Further Details:      
 
Domain Number 5 Region: 2-62
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 8.11e-23
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 6 Region: 638-695
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.24e-22
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 7 Region: 526-583
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.4e-22
Family Classic zinc finger, C2H2 0.0096
Further Details:      
 
Domain Number 8 Region: 750-805
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.6e-21
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 9 Region: 359-415
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.21e-19
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 10 Region: 321-370
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000084
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 11 Region: 277-329
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000158
Family Classic zinc finger, C2H2 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000378882
Sequence length 813
Comment ZNF484 (Homo_sapiens) zinc finger protein 484
Sequence
LFSQRAVSFEDVTVDFSREEWQHLDLAQKSLYRDVMLENYFNLISVGCQVPNLEVIFSWE
PGEEPCSLGSENSSQSYPSGNTGFEILQQELSEELFFQSEIIHLFIRDLELWKDDKWKGR
YEENQNKQSHVAFTNKATPANELDCEDTGKMVPVHTYLVTSRKGFHHSSTFGKSLKPIAS
LYHHNRNDATENLGKIIGYGDMFTPINSHPEMNICEANQCKELLSPKQHLIQCEKIHSEE
NLCLFSDFVKDFTQKSSLLSCLSIYAEEQQKCSKQTVFTQKPQHTVPQRVFTGEKPFMPT
EFGKDYSLRSNNQKTHNEENYYKCSEYGRGCIQKSDLFSCQQNLNGEKNYEYGQCGKNFS
QNSKLTVHKKVPTIGKHFECTECGKAFTRKSTLSMHQKIHTGEKPYVCTECGKAFIRKSH
FITHERIHTGEKPYECSDCGKSFIKKPQLLVHQRIHTGENPFICSECGKVFTHKTNLIIH
QKIHTGEKPYICTECGKAFTDRSNLIKHQKIHTGEKPYKCSDCGKSFIWKSRLRIHQKCH
SGERHYECSDCGKAFIQKSTLSMHQRIHKGEKPYVCTECGKAFFHKSHFITHERIHTGEK
PYECSGCGKSFTKKSQLHVHQQIHTGEKPYRCAECGKAFTDRSNLFTHQKIHTGEKPYKC
SDCGKAFTRKSGLHMHQQSHTGERHYECSDCGKAFARKSTLIMHQRIHTGEKPYICTECG
KSFIQKSHLNRHRRIHTGEKPYECSDCGKAFIKKSQLHEHHRIHTGEKPYICAQCGKAFT
IRSNLIKHQKIHTKQKPYKCSDLGKALNWKPQL
Download sequence
Identical sequences G5ALJ9
HGL_H00000378882

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]