SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000379144-2 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000379144-2
Domain Number 1 Region: 1516-1624
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.000000000494
Family Canonical RBD 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000379144-2
Sequence length 1787
Comment TNRC6A (Homo_sapiens) trinucleotide repeat containing 6A
Sequence
MEEKKKKKDDKKKKEAAQKKAHYTWSDSTQYIPSQMLQVEKETKTYLLQNPESESFTVSA
VDCLPQPQALPRYPREVPPRFRHQEHKQLLKRGQHFPVIAAKLGSAVKVLNSQSESSAVT
NQQPQNNGEVQSSENQSDINHNTSGSHYENSQRGPVSSTSDSSTNCKNTVINDLLEKEAW
PSVPGSDPELASECMDADSASSSESERNITIMASGSTGGEKDSLRNSTGLGSQNKFVVGS
SSNNVGHGSSPGPWGFSHGAIISTCQVSVDAPESKSESSNNRMNAWGTVSSSSNGGLNPS
TLNSASNHGAWPVLENNGLALKGPVGSGSSGINIQCSTVGQMPNNQSINSKVSSSTHGTW
GSLQETCESEVSGTQKVSFSGQPQNITTEMSGPNNTTNFMTSSLPNSGSVQNNELPGSNT
GAWRVSTMNHPQIQAPSVMNGTSLSHLSNGESKSGGSYGTTWGAYGSSYSGDKCSGPSGQ
ANGDTVNATLMQPGINGPVGTNFQVNTNKGGGVWESGAANSQSTSWGSGNGVNSGGSRRG
WGTPAQNTGTNIPSVEWNKLPSNQHSNDSANGNGKKFTNGWKSTEEEDQGSATSQTNEQS
SVWAKTGGAVESDGSTESTGRLEEKGTGESQSRDRRKLDQHTLLQSIVNRTDLDPRVLSN
SGWGQTPIKQNTAWDTETSPRGERKIDNGTEAWGSSATQTLNSGACVDKTSPNNNDTSSV
SGWGDPKPALRWGDSKGSNCQGGWEDDSAATGMIKSNQWGNCKEEKSTWNDSQKNKQGWG
DGQKSNPGWSVSASDNWGETSRSNHWGETNKKSSSGGSDSDRSISGWNELGKTSSFTWGN
NINPNNSSGWDESSKPNPSQGWGEPPKSNQSLGWGDSSKPVSSPDWNKQQDIVGSWGIPP
ATGKPPGTGWLGGPIPAPTKEEEPTGWEEPSPESIRRKMEIDDGTSAWGDPSKYNYKNVN
MWNKNVPNGSSRSDQQAQVHQLLPSASAISNKEASSGSGWGEPWGEPSAPATTVDNGTSA
WGKPIDSGPSWGEPIAAASSTSTWGSSSVGPQVLSKSGPKSMQDGWCGEDMPLPGNRPAG
WEEEEDVEIGMWNSNSSQELNSSLNWPPYTKKMSSKGLSGKKRRRERGMMKGGNKQEEAW
INPFVKQFSNISFSRDSPEENVQSNKMDLSGGMLQDKRMEIDKHTLNIGDYNRTVGKGPG
SRPQISKESSMERNPYFDKNGNPSVFGVGNTAAQPRGMQQPPAQPLSSSQPNLRAQVPPP
LLSPQVPVSLLKYAPNNGGLNPLFGPQQVAMLNQLSQLNQLSQISQLQRLLAQQQRAQSQ
RSVPSGNRQQQDQQGRPLSVQQQMMQQSRQLDPNLLVKQQTPPSQQQSLHQPAMKSFLDN
VMPHTTPELQKGPSPINAFSNFPIGAISSGFRLEESPFVPYDFVNSSTSPASPPGSIGDG
WPRAKSPNGSSSVNWPPEFRPGEPWKGYPNIDPETDPYVTPGSVINNLSINTVREVDHLR
DRNSGSSSSLNTTLPSTSAWSSIRASNYSVPLSSTAQSTSGSSWGESSSGRITNWLVLKN
LTPQIDGSTLRTLCMQHGPLITFHLNLLHGNALVCYSSKEEVVKAQKSLHMCVLGNTTIL
AEFASEEEISRFFAQGQSLTPSPGWQSLGSSQSRLGSLDCSHAFSSRTDLNHWNGAGLSG
TNCGDLHGTSLWGTPHYSTSLWGPPSSSDPRGISSPSPINAFLSVDHLGGGDSPCEAGGV
ASTCDLKTRRKGALSWARRLQPGPPVGTALLCTFSTLFSPKHISLNT
Download sequence
Identical sequences G5B947
HGL_H00000379144-2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]