SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000379168-1 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000379168-1
Domain Number 1 Region: 44-131
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 2.33e-36
Family SCAN domain 0.0000575
Further Details:      
 
Domain Number 2 Region: 452-508
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.62e-26
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 3 Region: 648-704
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.12e-25
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 4 Region: 591-648
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.89e-25
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 5 Region: 396-452
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.95e-25
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 6 Region: 535-592
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.31e-23
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 7 Region: 693-745
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.26e-20
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 8 Region: 165-224
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 9.15e-19
Family KRAB domain (Kruppel-associated box) 0.002
Further Details:      
 
Domain Number 9 Region: 498-530
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000239
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 10 Region: 338-396
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000129
Family Classic zinc finger, C2H2 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000379168-1
Sequence length 752
Comment ZNF287 (Homo_sapiens) zinc finger protein 287
Sequence
MLASRKRMNNSSRSQILLMWKSDKAQSGPHNFEKQTLTSKLLRDTETCRQNFRNFPYPDM
AGPRKALSKLRELCLKWLRPEIHSKEQILELLVLEQFLTILPGEVRTWVKSQYPESTEEV
VTLVEDLTQILQEEAPQNSALSQKTPEEDTRGKHVFQAGWLNDLVTEESMTFKDVAVDIT
QEDWELMRPVQKELYKTVTLQNYWNMVSLGLTVYRPTVIPILEEPWMVIKEILEGPSPEC
KTEAQTCIPVDNIPKLKQDGTQTIKLEELYDYDDGLEWQATDTFTKIPTNERDFSLKSVL
SQEDDPTEEYLSKYDIYKNDFEKHLNLTGQFDTQSDNKTFTYNEDKPVFNNFTYGTVYRK
ILPGDKPYKCNVCGKKFRKYPSLLKHQSSHAKEXXFRHISSLIAHQRMHTGEKPYECHQC
GKAFSQRAHLTIHQRIHTGEKPYKCNDCGKDFSQRAHLTIHQRTHTGEKPYKCLECGKTF
SHSSSLINHQRVHTGEKPYICNECGKTFSQSTHLLQHQKIHTGKKPYKCNECWKVFSQST
YLIRHQRIHSGEKCYKCNECGKAFAHSSTLIQHQTTHTGEKSYICNICGKAFSQSANLTQ
HHRTHTGEKPYKCNVCGKAFSQSVHLTQHQRIHNGEKPFKCNICGKAYRQGANLTQHQRI
HTGEKPYKCNECGKAFIYSSSLNQHQRTHTGERPYKCNECDKDFSQRTCLIQHQRIHTGE
KPYACRICGKTFTQSTNLIQHQRVHTGVKHRN
Download sequence
Identical sequences HGL_H00000379168-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]