SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000379227 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000379227
Domain Number 1 Region: 1228-1588
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 9.55e-123
Family Hect, E3 ligase catalytic domain 0.00000000972
Further Details:      
 
Domain Number 2 Region: 814-850
Classification Level Classification E-value
Superfamily WW domain 0.00000000000445
Family WW domain 0.0014
Further Details:      
 
Domain Number 3 Region: 204-302
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.000000000062
Family Synaptotagmin-like (S variant) 0.065
Further Details:      
 
Domain Number 4 Region: 998-1040
Classification Level Classification E-value
Superfamily WW domain 0.000000000144
Family WW domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000379227
Sequence length 1594
Comment HECW1 (Homo_sapiens) HECT, C2 and WW domain containing E3 ubiquitin protein ligase 1
Sequence
NLYQNRFLGLAAMASPSRNSQNRRRCKEPLRYSYNPDQFHNMDIRGGPHDGVTIPRSTSD
TDLVTSDSRSTLMVSSSYYSIGHSQDLVIHWDIKEEVDAGDWIGMYLIDEVLSENFLDYK
NRGVNGSHRGQIIWKIDASSYFVEPETKICFKYYHGVSGALRATTPSVTVKNSAAPIFKS
IGSDETTQGQGSRRLISFSLSDFQAMGLKKGMFFNPDPYLKISIQPGKHSIFPALPHHGQ
ERRSKIIGNTVNPIWQAEQFSFVSLPTDVLEIEVKDKFAKSRPIIKRFLGKLSMPVQRLL
ERHAIGDRVVSYTLGRRLPTDHVSGQLQFRFEITSSIHPDDEEISLSTEPESAETQSSLM
NSLVGSSRVEPPDDVPNPCEILKADPLSEDNEMDGAGNQSLEPAGPVEDVSCIMEAGDQG
KAFEEPEGAGEPQDTQPTLSAEELAEGLGLDEEAPPSLLLEDGDALANEEELGQEEAAPG
SGAGREEEEEEAEKQEQVEEEEVEMEEGEASNPEQGERALQLRALAKRRSRPCSLPVSEL
ETVIAAACADPETPRTHYIRIHALLHSLPCAREEGGADEEPTLRDASDKDALSEEADTLA
ADPPALDEDAAEPQGGLPGVGTPGHPEGLLPGPEGDAHPSTGSESDSSPRPGGEHSCEGC
DASCCSPSCYSSSCYSTSCYSSSCYSASCHSPSCYNGGSRFASHTRFSSVDSAKVSESTV
FSSQDDEDEENSAFESVPDSVQSPELDPEATNGTGPWQDELTAPGGTVARTAEGLESPMA
GPSHRREGECPILHNSQPVSQLPSLRPEHHHYPTIDEPLPPNWEARIDSHGRVFYVDHVN
RTTTWQRPTAAATPDGMRRSGSVQQMEQLNRRYQNIQRTIATERPEEDSGSQSYEQVPAG
GGGGGGSDSEAESSQSSLDLRREGSLSPVNSQKITLLLQSPAVKFLTNPEFFTVLHANYS
AYRVFTSSTCLKHMILKVRRDARNFERYQHNRDLVNFINMFADTRLELPRGWEIKTDQQG
KSFFVDHNSRATTFIDPRIPLQNGRLPNHLTHRQHLQRLRSYSAGEASEVSRNRGASLLA
RPGHSLVAAIRSQHQHESLPLAYNDKIVAFLRQPNIFEMLQERQPSLARNHALREKIHYI
RTEGNHGLEKLSCDADLVILLSLFEEEIMSYVPLQASFHPGYSFSPRCSPCSSPQNSPGL
QRASARAPSPYRRDFEAKLRNFYRKLEAKGFGQGPGKIKLIIRRDHLLEGTFNQVMAYSR
KELQRNKLYVTFVGEEGLDYSGPSREFFFLLSQELFNPYYGLFEYSANDTYTVQISPMSA
FVENHLEWFRFSGRILGLALIHQYLLDAFFTRPFYKALLRLPCDLSDLEYLDEEFHQSLQ
WMKDNNITDILDLTFTVNEEVFGQVTERELKSGGANTQVTEKNKKEYIERMVKWRVERGV
VQQTEALVRGFYEVVDSRLVSVFDARELELVIAGTAEIDLNDWRNNTEYRGGYHDGHLVI
RWFWAAVERFNNEQRLRLLQFVTGTSSVPYEGFAALRGSNGLRRFCIEKWGKITSLPRAH
TCFNRLDLPPYPSYSMLYEKLLTAVEETSTFGLE
Download sequence
Identical sequences G5AV45
HGL_H00000379227

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]