SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000379370 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000379370
Domain Number 1 Region: 37-126
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 5.04e-35
Family SCAN domain 0.0000683
Further Details:      
 
Domain Number 2 Region: 407-463
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.41e-25
Family Classic zinc finger, C2H2 0.003
Further Details:      
 
Domain Number 3 Region: 742-799
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.68e-24
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 4 Region: 799-855
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.85e-23
Family Classic zinc finger, C2H2 0.0077
Further Details:      
 
Domain Number 5 Region: 885-939
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.41e-22
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 6 Region: 518-575
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.5e-22
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 7 Region: 630-687
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.9e-21
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 8 Region: 211-267
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.79e-20
Family KRAB domain (Kruppel-associated box) 0.0022
Further Details:      
 
Domain Number 9 Region: 938-995
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.93e-20
Family Classic zinc finger, C2H2 0.0095
Further Details:      
 
Domain Number 10 Region: 463-519
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.45e-20
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 11 Region: 687-743
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.44e-19
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 12 Region: 574-631
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.51e-19
Family Classic zinc finger, C2H2 0.0093
Further Details:      
 
Domain Number 13 Region: 366-416
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.71e-17
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 
Domain Number 14 Region: 845-877
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000432
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000379370
Sequence length 1003
Comment ZNF197 (Homo_sapiens) zinc finger protein 197
Sequence
MTRENWAHNALPQEGLVKGKDDTWKWGPGYPGSSSSMWETSHMQFRQLRYHETSGPQEAL
SRLRELCRRWLRPEARTKAQILELLVLEQFLSILPGELQTWVQLHQPGSSEEAVALIEEL
QKYLDGPALKVPVLVHNQDTVQEGSSAPGAPLPPAPPSSHLAAEIHLNPLPDSGVFNLQD
PPHDSPAPEASTLSQEENPRNQLMALMLLTAQPQELVMFEEVSVCFTSEEWACLGPIQRA
LYWDVMLENYGNVTSLEWETMMENEEVTPKLSISQRADSQRETSKRLQEGVLQVLDFEEE
CEWQVLSDQLGNETQERVDTVKKVSICEEDKKKRTLPEKHGQKRKEFGESLTLGSAISES
LIGTDGKKFYKCDICFKHFNKISQLLNHQRIHTGEKPYTCKECGKGFIQRSSLRMHLRNH
SGEKPYKCNECGKAFSQSAYLLNHQRIHTGEKPYKCKECGKGFYRHSGLIAHLRRHSGDR
PFKCNECGKVFSQNGYLVDHQRLHRGEEPYKCNKCQKAFILKKSLILHQRIHSGEKPYKC
DECGKTFAQTTYLVDHQRLHSSENPYKCKECGKVFIRSKSLLLHQRVHTEKKTFGCKKCG
KIFSTKTNLIDHKRMHGREKPYKCTECGKAFTQSAYLFDHQRLHNGEKPYECNECGKIFI
LKKSLILHQRFHTGENLYECKDCGKVFGSNRNLIDHERLHNGEKPYECRECGKTFIMSKS
FMVHQKLHTQEKAYKCEDCGKAFSYNSSLLVHRRIHTGEKPFECSECGRAFSSNRNLIEH
KRIHSGEKPYECNECGKCFILKKSLIGHQRIHTREKSYKCNDCGKIFSYRSNLIAHQRIH
TGEKPYACNECGKGFTYNRNLTEHQRIHSGEKTYECHICRKVLTSSRNLMVHQRIHTGEK
PYKCTECGKDFSQNKNLLVHQRMHTGEKPYECEKCRKSFTSKRNLVGHQRIHTGEKPYGC
NDCSKVFRQRKNLTVHQKVHTDEKPCECVESGKEFSQTSNLHL
Download sequence
Identical sequences G5C211
HGL_H00000379370

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]