SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000379462 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  HGL_H00000379462
Domain Number - Region: 276-455
Classification Level Classification E-value
Superfamily Tropomyosin 0.00451
Family Tropomyosin 0.0049
Further Details:      
 
Domain Number - Region: 88-147
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0235
Family Myosin rod fragments 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000379462
Sequence length 672
Comment CTAGE5 (Homo_sapiens) CTAGE family, member 5
Sequence
MEGPEAALRPYLGSVLAELRRVRSWCYVGREKHLAIKLSKLIEEKCKLLEKVSLAQKEYE
GLESSLKDASFEKESTEAQSLEETYEMLDRNRLKLEDEILFLEKELNDEKSKHSEQDELM
ADVSEKIQALEDESKSLKSQVAEAKTTFKIFQINEERLKGAKKDALNENFQLQESQKQLL
QEVEVWKEQVSELNKQKVTFEDSKVCAEQVLNEKENHIKSLTEHLVKMKDWAAVLGEDLT
DDGNLELEVKSESSSGAQLDNEPKGALKKLIYAAKLNASLKSLEGERNQIYSQLSEVDKT
KEDLTEHIKNLQTEQASLQSENTQFESENQRLRQKLEVMTELYQENERKLHRKLTVEENY
RLEKDEKLSKLDERISHAAEELETYRTRAKDLEEELERTIQSYQGGIIPHEKRAHDNWLA
AQTAERNLNELRKENAYNRQRLTETEFKFELLEKDPYALDVPNTAFGRGSRGLENPLDHQ
ISNERGNSSYDRLTDPHRAPSDTGSLSPLWEQDRRVLIPPPDGPMSSETESRRNDTKDDL
GNSNVPDSSLPAESKATGPGFVPPPLPPVGGQPFLMYPRSQVLRRGPPFPPPPPGNMYGA
PRDYFPPRDFSGPPPPFPMRNVYPRGFPHYLPPRAGFFPPPPHSESRSEFPSGSIPPSNE
PAAEHPEPQQET
Download sequence
Identical sequences G5C809
HGL_H00000379462

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]