SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000379619 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000379619
Domain Number 1 Region: 405-606,803-946
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 2.35e-30
Family Quinoprotein alcohol dehydrogenase-like 0.039
Further Details:      
 
Weak hits

Sequence:  HGL_H00000379619
Domain Number - Region: 271-327
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.0156
Family WD40-repeat 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000379619
Sequence length 1864
Comment WDR72 (Homo_sapiens) WD repeat domain 72
Sequence
MDYEVLELAEDIWAADIKLDSSIRTGPEVRGLREMPPGATVNEGELVAVSGSAHCRAHSL
PSYKGANSVPAKLDHLHFCHERGYKKHTHLSVGKDVCGVGRSTPAPARLGPGDKGWGGLN
INLEAEGALVRRILVAQGTDLEQMQATHPCGGCRKGIFSDQLTRYFLSHSVQEAQHVETG
FLATSEDDCFLKLQSPCIQKPNGWMNSGQGRCGTLIRHWGDAAFRVSKVEPHLSLAGDVW
DRRHLLSPPWSPRDSGGMRTSLQAVALWGKKAPPHSISAIMITDDQRTIVTGSQEGQLCL
WNLSPELQFKQSPSFRRLVDPSWLDGSLAMRGSPRLHLSHACVERASWFGCRDEVAVRTL
HAPSLPALTSACSSGAAVCFSGLGYVVALAHIPCVCPPDISAKELLFGHSAAVRCLARAG
DFSKQPYIVSAAENGEMCVWNVTSGQCMRQATLPYRHMAVCYYHCSSRMAGDGWLLCCGE
YQDVLVVDARTLAVVHTLVSSQCPDWVTCMCTVHSVRVQEDSLLAVTVTGDLKVWDLSSA
INSIQEKRDVYEKESKFLDSVNCQTIRFCTYTERLLLVVFPRCWKVYDYCDFSLLWTEDS
SSGRLFAGGEVLAAHRVLVWTEDGRSYIYQLLNSGLSKSSTPADGRLLKETIYPHLLCSA
SAEENQSLPFVMGYVNERKEPFYKVLFSGEVSGRITLWHIPDVLVTKFDGSPREIPITTT
WTLQDNFDRHHMMSQSTLDRFPGPGGKAGAAAVTASEYVPGLDRLICGCEDGMVFITWAL
SAARAGLLDSGSVPTDPPAHKVLSGHQHGVTSLLYPHGLSSKSDQSWLLSGDQSSCVILW
DIFTEEVLHKFFLEAGPVTSLLMSPENFRLRADRAVCCVCGDHSVALLHLEEKRFLLRAR
KHLFPVTTVRWRPVENFLIVGCSDDSVYIWEIETGTLERHETGERARIILNCCGGSQLLK
PEPVLPATSETWKHRSVEQAPLGCHWPGPGTCPSAFASQAACAESCPRPFNVLPVKTKWS
SIGFHVLLFDLENLVELLLPTPPEHAGPSGSFHGSQLLRRARSTVGRKTLTSRRSGAACS
PEPQAPPAAVGLAQGRDAITFLEESEGVKWQRKTKSSRKTQPQPAQQVNASLILDTAKLF
LSCLLPWGVDPELDRLCTRHLNILKLQGPVSLGLASNQDHFSLMLPGGNLCSLETKTEYL
RVNLFSRKVLDLSNKYTATLPSQLGTSRGLENDCDFLQESNTITYLLSRLFLVNKLVNMP
LESACKIDRSFKVDSIHKVKSPVNDILNISSFYGYVRNGQSDCPVPEADLSLVKLISCWR
DQSVQVTEAIQAVLLAEVEQHMRSLRKTPADSCRVSPGWRDSRDGVPALPEEDRPEDLEL
QHLRSAWPMHSPGATFVGHQCVDFSPSQTGGAVVSAPVQSPEIQVLNLAFAAAAVRTLGG
PRSLRCRRACQGGRQGPWGPHSPSSRSHPSCSFTPTGGVRFGFDLKCPPEGSQCSEAGAL
PVVDSSMAAASPVKHDSNSEVANFQDSKDVPDRCVLEGSESPVLSLAHSHPGLLMAALRT
QVSPDTIPGSQRPFAVNIHMSPLCRTPAAHFSAAGLQAENRSLDTDTELCKTPVLGEVAG
QVALLGSLQVNLTAVTGKPKALPCPGLQRTRVCKALAMQGTCLQCRARPCGVDASVRAPQ
GSPDALEEVRVELDEAGEGESQGTKPWRGRASSCKAQDLARCVFWLFLKVKTTRKGNILN
QLRTSRQQDPTTKTLRQEDSRAAAESDRINGVRAPQGNCLRACGTLEKQGKVCPQGFREG
GLVLSVAVQGGGNTPERQSPAGSVTVSCDPPQGRSGSWWPRTSAREPPEPSRPSAMLLGL
RDWR
Download sequence
Identical sequences G5C9C7
HGL_H00000379619

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]