SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000379702 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000379702
Domain Number 1 Region: 401-458
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.06e-26
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 2 Region: 513-570
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.29e-26
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 3 Region: 289-346
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.58e-25
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 4 Region: 345-402
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.27e-25
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 5 Region: 569-626
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.71e-25
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 6 Region: 205-262
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.72e-25
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 7 Region: 457-514
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.77e-23
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 8 Region: 167-219
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.09e-20
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 9 Region: 1-43
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.18e-20
Family KRAB domain (Kruppel-associated box) 0.0016
Further Details:      
 
Domain Number 10 Region: 615-667
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.32e-20
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 11 Region: 252-284
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000014
Family Classic zinc finger, C2H2 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000379702
Sequence length 669
Comment ZNF665 (Homo_sapiens) zinc finger protein 665
Sequence
LTFRDVAIEFSQEEWKCLNPAQRTLYRDVMLENYRNLVSLDTSPKCIIKGSSPKGKKSTG
EIFKRVMLERHERSDIKGFSFRDVQKNIHGFEFQWKDDERNYNGLLVAQKKSLTGRRDQG
GKRDAGNKLMKNWLGLSFQSHLPELQTLQSEGKIDSNEVDKSINSAKPYKCNECGKVFTQ
NSHLTSHRRIHTGEKPYKCNECGKAFSVRSNLTNHHVIHTGEKPYKCNECGKVFSQTSSL
AIHRRTHTGEKPYRCNECGKVFSSHSNLNTHQVIHTGEKPYKCSECGKVFTQNSHLANHW
RIHTGEKPYKCHECGKAFSVYSSLTTHQAIHTGEKPYKCDECGKVFTQNSHLASHRGVHS
GEKPYKCDECGKVFSQTSNLARHWRVHTGEKPYKCNECGKAFSVRSSLTSHQVIHTGEKP
YKCNQCGKVFSQTSSLAIHQRIHTGEKPYKCNQCGKAFNSHSNLNTHQVIHTGEKPYKCS
ECGKVFTQNSHLANHRRIHTGEKPYKCMSVGKAFSVRSSLTSHQVIHTGEKPYKCNQCGK
VFSQTSSLAIHQRIHTGEKPYKCNQCGKAFNSHSNLNTHQVIHTGEKPYKCSECGKVFTQ
NSHLANHWRIHTGEKPYKCHECGKAFSVYSSLTTHQAIHTGEKPYKCDECGKVFTQNSHL
ASHRRTHTG
Download sequence
Identical sequences G5CBE3
HGL_H00000379702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]