SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000379719 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000379719
Domain Number 1 Region: 418-522
Classification Level Classification E-value
Superfamily occludin/ELL-like 2.62e-33
Family Occludin/ELL domain 0.00000157
Further Details:      
 
Weak hits

Sequence:  HGL_H00000379719
Domain Number - Region: 58-271
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.00418
Family LacY-like proton/sugar symporter 0.089
Further Details:      
 
Domain Number - Region: 275-355
Classification Level Classification E-value
Superfamily ADP-ribosylation 0.0403
Family ADP-ribosylating toxins 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000379719
Sequence length 524
Comment OCLN (Homo_sapiens) occludin
Sequence
MSSRPFESPPPYRPDEFKPNHYAPSNDIYGGEMHVRPMLSQPAYSFYPEDEILHFYKWTS
PPGVIRILSMLIIVMCIAIFACVASTLAWDRGYGTGLLGGGIGYPYGGSGFSGYGSGYGY
GYGYGYGYGAGYTDPRAAKGFLLAMAAFCFIASLVIFVTSVIRSELSRTRRYYLTVIILS
AILGIMVFIATIVYIMGVNPTAQASGSMYGSQIYALCNQFYAPAVSGLYMDQYLYHYCVV
DPQEAIAIVLGFLIVVAFALIIFFAVRTRGKMDRYDKSNILWDKERIYDEQPPNVEEWVK
NVSAGTQDMPPPPSDYVERVDSSMAYSSNGKVNGKQPYPEPSYKSTPLVPEVAQELPLTS
PVDDFRQPRYSSTSNFETPSKRAPTKGKAGKLKKAEQDHYETDYTTGGESCDELEEDWIR
EYPPITSDQQRQLYKRNFDSGLQEYKSLQAELDDVNKELSRLDKELDDYREESEEYMTAA
DEYNRLKEVKRSADYRNKRNYCKQLKSKLSHIKKMVGDYDRQKT
Download sequence
Identical sequences G5C0I2
XP_004872894.1.39548 XP_004872895.1.39548 XP_004872896.1.39548 XP_004872897.1.39548 HGL_H00000379719

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]