SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000379769 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000379769
Domain Number 1 Region: 33-550
Classification Level Classification E-value
Superfamily Aconitase iron-sulfur domain 1.31e-165
Family Aconitase iron-sulfur domain 0.00000000000000279
Further Details:      
 
Domain Number 2 Region: 557-767
Classification Level Classification E-value
Superfamily LeuD/IlvD-like 1.12e-60
Family LeuD-like 0.00000000221
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000379769
Sequence length 771
Comment ACO2 (Homo_sapiens) aconitase 2, mitochondrial
Sequence
MAPYSLLVTRLQKVLGVRQYHVASVLCQRAKVAMSHFEPNEYIRYDLLEKNINVVRKRLN
RPLTLSEKIVYGHLDDPANQEIERGKTYLRLRPDRVAMQDATAQMAMLQFISSGLPKVAV
PSTIHCDHLIEAQLGGEKDLRRAKDINQEVYNFLATAGAKYGVGFWRPGSGIIHQIILEN
YSYPGVLLIGTDSHTPNGGGLGGICIGVGGADAVDVMAGIPWELKCPKVIGVKLTGSLSG
WSSPKDVILKVAGILTVKGGTGAIVEYHGPGVDSISCTGMATICNMGAEIGATTSVFPYN
HRMKKYLSKTGRADIASLADEFKDHLVPDPGCQYDQLIEVNLNELKPHINGPFTPDLAHP
VAEVGTVAEKEGWPLDIRVGLIGSCTNSSYEDMGRSAAVAKQALAHGLKCKSQFTITPGS
EQIRATIERDGYAQILREVGGIVLANACGPCIGQWDRKDIKKGEKNTIVTSYNRNFTGRN
DANPETHAFVTSPEIVTALAIAGTLKFNPETDFLTGKDGKKFKLEAPDADELPQMEFDPG
QDTYQHPPKDSSGQRVDVSPTSQRLQLLEPFDKWDGKDLEDLQILIKVKGKCTTDHISAA
GPWLKFRGHLDNISNNLLIGAINIENGKANSVRNTLTQEFGPVPDTARYYKQHGIRWVVV
GDENYGEGSSREHAALEPRHLGGRAIITKSFARIHETNLKKQGLLPLTFADPADYNKIHP
VDKLTIQGLKDFAPGKPLTCVIKHPNGTQEXXXIEWFRAGSALNRMKELQQ
Download sequence
Identical sequences G5BPP6
HGL_H00000379769

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]