SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000379818 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000379818
Domain Number 1 Region: 117-225,347-463
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.85e-55
Family Phosphate binding protein-like 0.00000000849
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000379818
Sequence length 1130
Comment GRIN2A (Homo_sapiens) glutamate receptor, ionotropic, N-methyl D-aspartate 2A
Sequence
MRFMVNVTWNGKDLSFTEEGYQVHPRLVVIVLNKDREWEKVGKWENQTLSLRHAVWPRYK
SFSDCEPDDNHLSIVTLEEAPFVIVEDIDPLTETCVRNTVPCRKFVKINNSTNEGMNVKK
CCKGFCIDILKKLSRTVKFTYDLYLVTNGKHGKKVNNVWNGMIGEVVYQRAVMAVGSLTI
NEERSEVVDFSVPFVETGISVMVSRSNGTVSPSAFLEPFSASVWVMMFVMLLIVSAIAVF
VFEYFSPVGYNRNLAKGKAPHGPSFTIGKAIWLLWGLVFNNSVPVQNPKGTTSKIMVSVW
AFFAVIFLASYTANLAAFMIQEEFVDQVTGLSDKKFQRPHDYSPPFRFGTVPNGSTERNI
RNNYPYMHQYMTKFNQKGVEDALVSLKSGKLDAFIYDAAVLNYKAGRDEGCKLVTIGSGY
IFATTGYGIALQKGSPWKRQIDLALLQFVGDGEMEELETLWLTGICHNEKNEVMSSQLDI
DNMAGVFYMLAAAMALSLITFIWEHLFYWKLRFCFTGMCSDRPGLLFSISRGIYSCIHGV
HIEEKKKSPDFNLTGSQSNMLKLLRSAKNISNMSNMNSSRMDSPKRTADFIQRGSLIMDM
VSDKGNLIFSDNRSFQGKDSIFGDNMNELQTFVANRHKDNLNNYVFQGQHPLTLNESNPN
TVEVAVSTESKGNSRPRQLWKKSMESLRQDSLSQNPASQRDEGTVENRSHSLKSPRYLPE
EVAHSDISETSSRATCHREPNNNKNHKTKDNFKRSMASKYPKDCSEVERTYLKTKASSPR
DKIYTIDGEKEPSFHLDPPQFVENISLPENVGFPDAYQDHGENFRKGDSTLPVNRNPLHN
EDGLPNNDQYKLYAKHFTLKDKGSPHSEGSDRYRQNSTHCRSCLSNLPTYSGHFTMRSPF
KCDACLRMGNLYDIDEDQMLQETGNPASQEGVYQEDWAQNNALQGQKNKLRINRQHSYDN
ILDKPREMDLSKPSRSISLKDRERLLEGNLYGSLFSVPASKLSGNKSSLFPQGLEDSKRS
KSLLPDHTSDNPFLHSYRDDQRLVIGRCPSDPYKHSLPSQAANDNYLQSSLRSTASYCSR
DSRGHSDVYISEHVMPYAANKNNMYSTPRVLNSCSNRRVYKKMPSIESDV
Download sequence
Identical sequences G5BWG2
HGL_H00000379818

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]