SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000379855 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000379855
Domain Number 1 Region: 117-295
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 6.47e-37
Family BCR-homology GTPase activation domain (BH-domain) 0.000000048
Further Details:      
 
Domain Number 2 Region: 619-725
Classification Level Classification E-value
Superfamily SH2 domain 7.27e-31
Family SH2 domain 0.000000653
Further Details:      
 
Domain Number 3 Region: 323-430
Classification Level Classification E-value
Superfamily SH2 domain 4.04e-30
Family SH2 domain 0.000000627
Further Details:      
 
Domain Number 4 Region: 4-83
Classification Level Classification E-value
Superfamily SH3-domain 4.46e-17
Family SH3-domain 0.00000489
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000379855
Sequence length 728
Comment PIK3R1 (Homo_sapiens) phosphoinositide-3-kinase, regulatory subunit 1 (alpha)
Sequence
MSAEGYQYRALYDYKKEREEDIDLHLGDILTVNKGSLVAHGFSDGQEARPEEIGWLNGYN
ETTGERGDFPGTYVEYIGRKKISPPTPKPRPPRPLPVAPGSSKTEADIEQQALTLPDLAE
QFAPPDIAPPLLIRLVEAIEKKGLECATLYRTQSSSNSVELRQLLDCDVASMDLEMVDVQ
VLADAFKRYLLDLPNPVIPVAVYSEMISLAQEVQSSEDYIQLLKKLIRSPNIPHQYWLTL
QYLLKHFFKLSQSSSKNLLSARVLAEIFSPMLFRFPAASSDSTENLIKVIEILISTEWNE
RQPAPALPPKPPKPTTVANNGMNNNMSLQDAEWYWGDISREEVNEKLRDTADGTFLVRDA
STKMHGDYTLTLRKGGNNKLIKIFHRDGKYGFSDPLTFNSVVELINHYRNESLAQYNPKL
DVKLLYPVSKYQQDQVVKEDNIEALHEYNTQFQEKSREYDRLYEEYTRTSQEIQMKRTAI
EAFNETIKIFEEQCQTQERYSKEYIEKFKREGNEKEIQRIMHNYDKLKSRISEIIDSRRR
LEEDLKKQAAEYREIDKRMNSIKPDLIQLRKTRDQYLMWLTQKGVRQKKLNEWLGNENTE
ENLLSCLLSQYSLVEDDEDLPHHDEKTWNVGSSNRNKAENLLRGKRDGTFLVRESSKQGC
YACSVVVDGEVKHCVINKTATGYGFAEPYNLYSSLKELVLHYQHTSLVQHNDSLNVTLAY
PVYAQQRR
Download sequence
Identical sequences G5C7Q9
HGL_H00000379855

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]