SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000380006 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000380006
Domain Number 1 Region: 580-720
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.93e-32
Family Synaptotagmin-like (S variant) 0.047
Further Details:      
 
Domain Number 2 Region: 1417-1547
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 6.25e-23
Family Synaptotagmin-like (S variant) 0.017
Further Details:      
 
Domain Number 3 Region: 447-506
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000000583
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0027
Further Details:      
 
Domain Number 4 Region: 20-115
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.0000000000000569
Family PLC-like (P variant) 0.0000118
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000380006
Sequence length 1589
Comment UNC13B (Homo_sapiens) unc-13 homolog B (C. elegans)
Sequence
MLELIRGAMLGSRALGLRVEISRLDLGLSVEVWNKGLIWDTMVGTVWIALKTIRQSDEEG
PGEWSTLEAETLMKDDEICGTKNPTPHKILLDTRFELPYDIPEEEARYWTYKLEQINALE
ADNEYSMQDRSQRKPLSTAAAQCCHWTYLGWGEQQTFEDPDSAVDDRDSDYRSETSNSVP
PPYHTTSQPNASVHQFPVPVQLPQQLLLQGSSRDSCNDSIQSYDFDYPERRALSPTSSSR
YGSSCNVSQGSSQLSELDQYHEQDDDRRERDSIHSCHSSGSLSRDDQASFGEQEKALEMR
GEAKKRRACEPKETTDVTTHPPPDLVLHKDHVVGPQESLPEENASSPFTHARAHWIRAVT
KVRLQLQEIPDDGNPCLPQWLPEGPAGGLYGIDSMPDLRRKKPLPFVSDLSLVQSRKAGI
TSAMATRTSFKDEELKSHVYKKTLQALIYPISCTTPHNFEVWTATTPTYCYECEGLLWGI
ARQGMRCSECGVKCHEKCQDLLNADCLQRAAEKSCKHGAEDRTQNIIMAMKDRMKIRERN
KPEIFEIIRDVFTVSKVAHVQQMKTVKQSVLDGTSKWSAKITITVVCAQGLQAKDKTGSS
DPYVTVQVGKTKKRTKTIFGNLNPVWEEKFHFECHNSSDRIKVRVWDEDDDIKSRVKQRL
KRESDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLQISVEIKGEEKVAPYHV
QYTCLHENLFHYLTDIQGSGGVQIPEARGDDAWKVYFDETAQEIVDEFAMRYGIESIYQA
MTHFACLSSKYMCPGVPAVMSTLLANINAYYAHTTASTNVSASDRFAASNFGKERFVKLL
DQLHNSLRIDLSTYRNNFPTGSPERLQDLKSTVDLLTSITFFRMKVQELQSPPRASQVVK
DCVKACLNSTYEYIFNNCHDLYSRQYQLKQELPPEEQGPSIRNLDFWPKLITLIVSIIEE
DKNSYTPVLNQFPQELNVGKVSAEVMWHLFAQDMKYALEEHEKDRLCKSADYMNLHFKVK
WLHNEYMRDLPALQEQVPKYPAWFEQFVLQWLDENEDVSLEFLRGALERDKKDGFQQTSE
HALFSCSVVDVFTQLNQSFEIIRKLECPDPRILAHYMRRFAKTIGKVLMQYADILSTNFP
AYCTKEKLPCILMNNMQQLRVQLEKMFEAMGGKELDPEAADSLKELQVKLNAVLDELSMM
FGNSFQVRIDECVRQMADILGQVRGTGNASPNTRASVAQDADSVLRPLMDFLDGNLTLFA
TVCEKTVLKRVLKELWRVVMNTMERMIVLPPLTDQTGTQLIFTAAKELSQLSKLKDHMVR
EETRNLTPKQCAVLDLALDTIKQYFHAGGNGLKKTFLEKSPDLQSLRYALSLYTQTTDTL
IKTFVRSQTAQVHDGKGIRFTTNEDIRPEKGSGVDDPVGEVSIQVDLFTHPGTGEHKVTV
KVVAANDLKWQTAGMFRPFVEVTMVGPHQSDKKRKFTTKSKSNNWAPKYNETFHFLLGNE
EGPETYELQICVKDYCFAREDHVLGLAVMPLRDVTAKGSCACWCPLGRKIHMDETGMTIL
RILSQRSNDEVAREFVKLKSESRSTEEGS
Download sequence
Identical sequences G5BL08
HGL_H00000380006

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]