SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000380087 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000380087
Domain Number 1 Region: 39-128
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 3.48e-38
Family SCAN domain 0.0000405
Further Details:      
 
Domain Number 2 Region: 349-406
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.27e-23
Family Classic zinc finger, C2H2 0.0027
Further Details:      
 
Domain Number 3 Region: 311-363
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.95e-19
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 
Domain Number 4 Region: 391-443
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.89e-19
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 5 Region: 201-236
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0000000000732
Family KRAB domain (Kruppel-associated box) 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000380087
Sequence length 451
Comment ZNF213 (Homo_sapiens) zinc finger protein 213
Sequence
MASPQEPQDQAPGEGEGLLIVKVEDSSWEQESGQQEDRRNSEACRQRFRQFCYREVGGPH
EAFSQLWELCCRWLRPELHTKEQILELLVLEQFLMVLPGEIQAQVRGQCPGNGEEAVALV
EDLQKQPVKAWWQDRPSEDKEPEAVVQTSQAKGMVGVWSELPAPQDQPTHRAQLPALLKE
RSTRETPDACFASGVHGPGGLGDIPFYFSREEWGSLDPAQRDLFWDIKRENSRNTTLGLE
LQSQNKRALLEEVKVLPGQAGGERTVSCSPREAKAWRREHQPGASLGRPVGARPGRPPTC
RRQFQDLAAEKPHSCGQCGKRFRWGSDLARHQRTHTGEKPHKCPECDKSFRSSSDLVRHQ
GVHTGEKPFSCTECGKSFSRSAYLADHQRIHTGEKPFGCSDCGKSFSLRSYLLDHRRVHT
GERPFGCGECDKSFKQRAHLIAHQSLHAKTA
Download sequence
Identical sequences G5B1I5
XP_004864783.2.39548 XP_012921004.1.39548 HGL_H00000380087

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]