SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000380116 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  HGL_H00000380116
Domain Number - Region: 475-526
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 0.0549
Family Retrovirus capsid protein C-terminal domain 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000380116
Sequence length 527
Comment C19orf55 (Homo_sapiens) Uncharacterized protein C19orf55
Sequence
MRSLFPTGITPQTSLFFLYVPLLYALNPSSSQSSRLPQAPKVSANSPELFEEFWPSSSGT
SSPPSTTEGQMDSSSPPTLTDSGESVVAKYINRFRQAQPTSREERQCTDPTPTDFWWLQT
ESSDPSSQLAAAAPAPAQAPIXXXXXXXXPLRPDDILYQWRQRRKLEQAQGVKGHGTWVL
PQTPALATPSAPAVTLGSLATQPTWVPLWGSVAQPSPPEAFYVERPPVPLESSPHIFWAP
NTHGFFWTPQSSPWVSLGTAPPPPLASTPVPLAPPGPPASTSAPPVSSQTSLASIPAPLA
SSNSTPPTTAPTSSTTLQSPPTPEPSSSSQPENVGPKPRKARASGWEAAGQVTAAFEGPG
AQLRGALGQVVTARLFSDSLEDTPPRREAPPLEVKATPSRARATPPRSESSCPSKVKTMP
SPDESVLRQGKVTPSAKAGSPKPKVLPSPAERVSTLPEAPSPLLESGSLVAAAPPLSAIH
HDPSEDLFSQAARLLEAAEDSDGSEFQDDPVLQVLRAQRAELRLQKR
Download sequence
Identical sequences G5BXN6
HGL_H00000380116

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]