SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000380150 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000380150
Domain Number 1 Region: 12-110
Classification Level Classification E-value
Superfamily DEATH domain 5.65e-21
Family Caspase recruitment domain, CARD 0.011
Further Details:      
 
Domain Number 2 Region: 736-816
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000138
Family PDZ domain 0.02
Further Details:      
 
Domain Number 3 Region: 1202-1303
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000372
Family Nucleotide and nucleoside kinases 0.0041
Further Details:      
 
Weak hits

Sequence:  HGL_H00000380150
Domain Number - Region: 172-433
Classification Level Classification E-value
Superfamily Tropomyosin 0.000654
Family Tropomyosin 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000380150
Sequence length 1308
Comment CARD11 (Homo_sapiens) caspase recruitment domain family, member 11
Sequence
MDEYMETLKDEEDALWENVECNRHMLSRYINPAKLTPYLRQCKVIDEQDEDEVLSAPMLP
SKINRAGRLLDILHTKGQRGYVVFLESLEFYYPELYKLVTGKEPTRRFSTIVVEEGHEGL
THFLMNEVIKLQQQMKAKDLQRCELLAKSRQLEDEKKQLTLTRVELLTFQDRYYKMKDER
DSYNDELVKVKDDNYNLAMRYAQLSEEKNMAVMRSRDLQLEIDQLKHRLNKMEEECKLER
NQSLKLKNDIESRPKKEQVLELERENEMLKTKIQELQSIIQAGKRSLPDSDKAILDILEH
DRKEALEDRQELVNKIYNLQEEVRQAEELRDKYLEEKEDLELKCSTLGKDCEMYKHRMTT
VMLQLEEVERERDQAFHSRDEAQTQYSQCLIEKDKYRKQIRELEEKNDEMRIEMVRREAC
IVNLESKLRRLSKDSGTLDQSLPRNLPATIIPQSFGDASPRTNGQEADDSSTSEESPEDS
KYFPPYHPPRRRMNLKGIQLQRAKSPISLKRASDFQVKGFGDDTTDASPSSARSLPITSS
FSKMQPHRSRSSIMSITAEPPGNDSIVRRCKEDAPPRSAVEEDNDSCGFDALELDDDSHD
RYSFGPPSIHSSSSSHQSESLDAYDLEQVNLMFRKFSLERQPSVPLASPGPDGPRSSADD
SHDRYSFGPPSIHSSSSSHQSESLDAYDLEQVNLMFRKFSLERPFRPSVTSVGQVRGPGP
SVQHATVNGDGLFTQLTLLGGNARGSFVHVVKQGSLAEKAGLREGHQLLLLEGCIRGERQ
SVPLDTCTKEEARWTIQRCSGPVTLHYKANHEGYQKLLRDMAEGLITSGDSFYIRLNLNI
SSQLDACSMSLKCDDIVHVRDTMYQDRHEWLCARVDPFTDHDLDMGTIPSYSRAQQLLLV
KLQRLMHRGNREEADTVHHTLRGLRNTLQPEEPLSTSDPRVSPRLSRASFLFGQLLQFVS
RSENKYKRMNSSERVRVISGSPLGSLARASLDATRLSAEKQEGVCLVRAFHCERRRPVLF
TPTVLTKTLVQKLLNSGGAMELTLCKSDTVTREEFLKKQKTETIIYSREKNPNTFECIVP
ANIEAVAAKAGRSSRTDGEAGRGTLLTSLSHTPQNKHCLLEAGMGCVRDLIKCGIYPIVL
FVRVCEKNIKRFRHSVQGFRRQWDQGRQSQQHTVALSEVPGGPGKTLHHSGQERDHFPRL
FRNKHCLLEAGMGCVRDLIKCGIYPIVLFVRVCEKNIKRFRKLLPRPETEEEFLRACRLR
EKELEALPCLYSTVEAEAWSSVEELLRVLKDRICEEQRKTIWVDEDQL
Download sequence
Identical sequences G5BPW3
HGL_H00000380150

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]