SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000380258 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000380258
Domain Number 1 Region: 28-262
Classification Level Classification E-value
Superfamily ADP-ribosylation 1.3e-76
Family Ecto-ART 0.0000371
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000380258
Sequence length 308
Comment ART5 (Homo_sapiens) ADP-ribosyltransferase 5
Sequence
MTLEALLIVLNCLGLRTLWQAQAVPILPLGLAPDTFDDAYVGCSEVMEEKAAALLKEEMA
HHALLRESWEAAQEAWEYQRRGLTLPPGFKAQHGIAIMVYTNSSNTLYWELNQAVRTGGG
SREHYMRHFPFKALHFYLTRGLQLLQGSGGCSRAPGAVVFRGVSSLHFEPKRLGDLVRFG
QFASSSLDEAVARRFGNATFFSLRTCFGASIQALSVFPEEREVLIPPHEVFLVTGFSQDG
ARSIVTLWSYNQTCSHFNCAYLGGQKRRGCVSVPVGQPESPYEGAFPLLSWKTPFLAPGK
FQLSEAGP
Download sequence
Identical sequences G5AVS7
HGL_H00000380258

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]