SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000380272-5 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000380272-5
Domain Number 1 Region: 661-718
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.12e-21
Family Classic zinc finger, C2H2 0.0082
Further Details:      
 
Domain Number 2 Region: 465-522
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.07e-21
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 3 Region: 802-858
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.11e-21
Family Classic zinc finger, C2H2 0.0079
Further Details:      
 
Domain Number 4 Region: 997-1052
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.57e-21
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 5 Region: 718-774
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.37e-20
Family Classic zinc finger, C2H2 0.0082
Further Details:      
 
Domain Number 6 Region: 521-578
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.75e-20
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 7 Region: 941-998
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.7e-20
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 8 Region: 577-634
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.72e-20
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 9 Region: 241-298
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.17e-19
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 10 Region: 297-354
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.58e-19
Family Classic zinc finger, C2H2 0.0095
Further Details:      
 
Domain Number 11 Region: 410-466
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.98e-19
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 12 Region: 858-914
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3e-19
Family Classic zinc finger, C2H2 0.0085
Further Details:      
 
Domain Number 13 Region: 189-242
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.89e-18
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 14 Region: 2-42
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 7.59e-18
Family KRAB domain (Kruppel-associated box) 0.00087
Further Details:      
 
Domain Number 15 Region: 353-410
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.31e-16
Family Classic zinc finger, C2H2 0.0079
Further Details:      
 
Domain Number 16 Region: 143-193
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000321
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 17 Region: 764-796
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000002
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 18 Region: 904-936
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000608
Family Classic zinc finger, C2H2 0.0089
Further Details:      
 
Domain Number 19 Region: 624-656
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000305
Family Classic zinc finger, C2H2 0.0092
Further Details:      
 
Domain Number 20 Region: 67-115
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000814
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000380272-5
Sequence length 1053
Comment ZNF91 (Homo_sapiens) zinc finger protein 91
Sequence
TVTFEDVAVNFTMEEWTLLNPSQKKLYRDVMRETFRNMTAIADSLACREPLIGHLSQNVP
LIAHTALKPYKYLGSEESHYKCDQRGRNRSDFHSFQKHARTKAGEKPCEHDQCGKISCDL
SERTHLRENAFVCKKNLAASSTDSDVQIHERNHSEGKPYVCKQCGKAFRTYKYVQIHERN
HSGGKPYGSSHCQTHERVHTGEKPYVCKQCGKAFRTKSACQRHEKVHSLEKPYVCKQCGK
AFSSYGTFKTHERFHTGEKPYVCKQCGKAFRTKSACQRHEKVHSLEKPYVCKQCGKAFSS
YGTFKTHERFHTGEKPYVCKHCGKAFSTSSHCRIHERAHTGYKPYECKRCGKAFTTHIYS
QIHESFHTGVKPYSCKQCGKAFSTSSYCRIHERAHTGYKRYECKQCGNIFSTCGYVQIHE
RAHTGYKPYECKQCGKAYSTKSSCQRHEKLHSGEKPYVCKQCGKSFSSYGTFKTHERFHS
GEKPYVCKQCGKAFSTSSHCRTHERIHTGEKPYVCKQCGKAFSTSGYCRIHERFHTGEKP
YVCKQCGKAFSTKSACQRHERVHSGEKPYVCMKCGKAFTTRRCCQRHESVHTGEKPYACK
QCGKAFSTKSVCQRHEKVHSGEKPYVCKQCGKAFSTHIYSQIHERVHSGMKPYVCKQCGK
AFSTKSASRTHERVHTGEKPYICKQCGKGFSSYSTCKTHERVHTGEKPYICKQCGKGFSS
YSTCKTHERVHTGEKPYICKQCGKGFSSYSTCKTHERVHTGEKPYICKQCGKGFSSYSTC
KTHERVHTGEKPYICKQCGKGFSSYSTCKTHERIHTGEKPYICKQCGKAFSSYSTCKTHE
RVHTGEKPYICKQCGKGFSSYSTCKTHERVHTGEKPYICKQCGKAFSTSSYCRIHERAHE
GYKPYECKQCGKAYSTKSACQRHEKVHSGEKPYVCKKCGKAFTTRKCCQRHEKVHTGEKP
YACKQCGKAFSAKSSYQRHEKVHNGEKPYVCKKCGKAFTTQKCCQRHERVHTGEKPYVCK
QCGKAFSKSSHFREHERIHTGEKPYECKQCGKA
Download sequence
Identical sequences G5BK82
HGL_H00000380272-5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]