SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000380293 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000380293
Domain Number 1 Region: 473-530
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.96e-25
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 2 Region: 642-699
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.86e-24
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 3 Region: 586-643
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.47e-24
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 4 Region: 698-755
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.9e-23
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 5 Region: 852-904
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.39e-23
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 6 Region: 416-474
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.1e-23
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 7 Region: 810-867
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.34e-22
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 8 Region: 529-587
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.28e-22
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 9 Region: 331-389
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.55e-20
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 10 Region: 754-811
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.03e-20
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 11 Region: 2-46
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.58e-19
Family KRAB domain (Kruppel-associated box) 0.0017
Further Details:      
 
Domain Number 12 Region: 379-411
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000772
Family Classic zinc finger, C2H2 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000380293
Sequence length 913
Comment ZNF99 (Homo_sapiens) zinc finger protein 99
Sequence
LLTFRDVAIDFSPEEWECLEPAQWNLYRDVMLENYRNLVFLAVSTHYTQAFSGDQCIKHL
FQNMKKRRNGNYGLDNLYLRKEWESIGKSEGQNLCYAGHNQCVIPVHNKNFFVNRDEEYT
SSQKISQFMPVTSKEPSVCISKYPHQFLKHNFPLKGNLENLKRDLLHATRLNLNLNISID
NGFKNEEMSKCDQFENPFRKSSSCNQETISPFVKIHNCNEYEIFTYPLLINPNADTDIWK
VHYIRNETTKTLSQGSTLNNYPDTYICEKIYERDENFIYGSNTWKHEWTCFPKNLYLDKK
HGKIFKYSNFATFPSVHIQDKTYKYKKCGKAFNQISGLTQHQKIHSGEKTYKCKECGKAF
TQDSRLKQHLQIHWVGEKPYKYKECGKAFNQISGLTQNQRIYTGDQLYKCKECGKTFTQD
SRLRQHLRIHNTGEKPYKCKECGKTFNQTSGLSRHQRIHTGEKPYKCKECGKAFAQDSSL
RQHQRIHTGEKPYKCKECGKTFNQISVLTRHHSIHTGEKPYKCKECGKAFNRLSYVAQHY
RIHTGEKPYKCNECGKAFTLYSSLRNHLGIHNTGEKPYKCKECGKAFNQIANLSVHKRIH
TGEKPYKCKECGKAFNVRSNLTQHQKHHTGERPYQCKECGKSFIQISNLIQHRRIHIGGK
PYKCKDCGKAFNQSSNLIRHQIIHLGEKPYRCKQCGKAFNGSSNLTLHQRVHTGDKPYKC
KECGKAFKRISSVTVHQRIHTGEKPYKCEECVKAFSDCSALIQHKRIHTGEKRYKCKECG
EGFNKSSRLTMHQRIHKGGKLYNCKECGKVFNDCSTLTNHHSIHTGERPYKCKECGKAFN
DRSTLAQHHRIHTGERPYKCKECGKAFTQSSHLTRHQRIHTGEKPYKCKICGKAFNQSSN
LTQHQNIHSEGKL
Download sequence
Identical sequences G5BGP2
HGL_H00000380293

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]