SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000380315-1 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000380315-1
Domain Number 1 Region: 896-953
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.16e-22
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 2 Region: 728-785
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.55e-21
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 3 Region: 280-337
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.97e-21
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 4 Region: 784-841
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.71e-21
Family Classic zinc finger, C2H2 0.0085
Further Details:      
 
Domain Number 5 Region: 224-281
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.79e-21
Family Classic zinc finger, C2H2 0.009
Further Details:      
 
Domain Number 6 Region: 336-393
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.11e-20
Family Classic zinc finger, C2H2 0.0082
Further Details:      
 
Domain Number 7 Region: 1064-1121
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2e-20
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 8 Region: 840-897
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.73e-20
Family Classic zinc finger, C2H2 0.0079
Further Details:      
 
Domain Number 9 Region: 505-561
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.38e-20
Family Classic zinc finger, C2H2 0.007
Further Details:      
 
Domain Number 10 Region: 560-617
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.3e-20
Family Classic zinc finger, C2H2 0.0084
Further Details:      
 
Domain Number 11 Region: 393-449
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.59e-19
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 
Domain Number 12 Region: 952-1009
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.83e-19
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 13 Region: 672-729
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.51e-19
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 
Domain Number 14 Region: 448-505
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.6e-19
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 15 Region: 1008-1065
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.62e-19
Family Classic zinc finger, C2H2 0.0079
Further Details:      
 
Domain Number 16 Region: 2-47
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.44e-18
Family KRAB domain (Kruppel-associated box) 0.00078
Further Details:      
 
Domain Number 17 Region: 1106-1158
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.39e-17
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 18 Region: 616-673
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.54e-16
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 
Domain Number 19 Region: 176-225
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000078
Family Classic zinc finger, C2H2 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000380315-1
Sequence length 1163
Comment ZNF208 (Homo_sapiens) zinc finger protein 208
Sequence
EAVTFEDVAMNFSREEWALLDPSQKKLYRDVMWETLRNLAAIGESFSSRRPLIGHLSADG
PIMANTQLKSYEQHGFQEKLSNCNKHETTCTKLQSFQKCAKTISGEKPHEYMSCGKSYCD
CTKESTIEEDPFAYKQDVKSFRIPNDGQIRGKSHSEVNTYICIPCGKGSNSHHGIQTDEK
AHIGKKTYVGKHYGKSFTNNNSFGNHERTHIGEKHYVCKQCGKAFSTKYNCQIHERRHTG
EKLYVCKQCGKAFSRQYSCQIHERTHTGEKPYECKQCGKAFSTQSYCQIHERTHTGEKPH
VCKQCGKAFSTNKDCQRHERIHTGEKPYLCKLCGKAFSTHGHCQTHERSHTGEKPYVCKQ
CGKAFSTHSSCQRHERSHTGEKPYVCEQCGKGFIIQSRCQMHERTHTGEKPYVCKQCGKA
FTMQRHCQKHERTHTREKPYICTQCGKAFTTQSYCEIHERTHTGEKPYVCSLCGKAFSTH
SYCQTHEKTHTGQKSYVCTQCGKGFSTHSYCEIHERTHTGEKPHICKQCGKAFSRNKDCK
IHERSHTGEKPYVCKQCGKAFSTHGSCQRHERSHTGEKPYVCKQCEKAFSTHGSCRIHER
SHTGEKPYVCKQCGKAFSTHGSCQRHERNHTGEKPYVYKYCGNFFTNNDLFDDHERTHIG
EKCYVCKQCGKAFSRHAYCQTHERRHTGEKPYICKVCGKAFSTNGVCQRHQQTHTGKKPY
VCKHCGKAFSTHAHCQIHERTHTGEKPYVCRQCGKAFSTGGDCQRHERTHTGEKPYVCKQ
CGKAFSTHAHCQTHERTHTGEKPYVCKQCGKAFSTQSYCQTHERTHSGEKPYICKQCGKA
FSTHSYCQIHEQTHTGEKPYICKQCGKAFSTHRYCQIHVRTHTGEKPYVCKQCGKAFSTH
KDCQIHVRTHTGEKPYVCKQCGKAFNRKASWRIHERTHTGEKPYVCKQCGKAFSEHRNCQ
RHIRTHTGDKPYVCKQCGKAFSRHSYCQAHERTHTRGKPYVCKQCGKAFSRQYTCQLHER
SHSVEKPYACKQCGKAFSTLSVHQKHEWTHTGEKPYVCKQCGKAFRTHRICQAHERTHSG
EKPYVCQQCGKAFSRQDNCQRHERSHTGEKPYVCKQCGKAFSTHSYCQTHERTHTGEKPY
VCKQCGKAFSTHRNCQRHVRTHS
Download sequence
Identical sequences G5ANF7
HGL_H00000380315-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]