SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000380315-3 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000380315-3
Domain Number 1 Region: 856-913
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.66e-23
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 2 Region: 184-241
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.16e-22
Family Classic zinc finger, C2H2 0.0069
Further Details:      
 
Domain Number 3 Region: 1024-1081
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.85e-22
Family Classic zinc finger, C2H2 0.0079
Further Details:      
 
Domain Number 4 Region: 968-1025
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.27e-22
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 5 Region: 744-801
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.91e-22
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 6 Region: 800-857
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.39e-21
Family Classic zinc finger, C2H2 0.0063
Further Details:      
 
Domain Number 7 Region: 912-969
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.34e-21
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 8 Region: 240-297
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.68e-21
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 9 Region: 297-353
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.19e-21
Family Classic zinc finger, C2H2 0.009
Further Details:      
 
Domain Number 10 Region: 352-409
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.67e-21
Family Classic zinc finger, C2H2 0.0077
Further Details:      
 
Domain Number 11 Region: 2-56
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 6.41e-20
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 12 Region: 548-605
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2e-19
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 
Domain Number 13 Region: 632-689
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.55e-19
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 
Domain Number 14 Region: 464-521
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.63e-19
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 
Domain Number 15 Region: 408-465
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.71e-19
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 
Domain Number 16 Region: 688-745
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.95e-19
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 
Domain Number 17 Region: 1070-1122
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.4e-17
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 
Domain Number 18 Region: 132-185
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.12e-17
Family Classic zinc finger, C2H2 0.0093
Further Details:      
 
Domain Number 19 Region: 511-543
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000493
Family Classic zinc finger, C2H2 0.0077
Further Details:      
 
Domain Number 20 Region: 595-627
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000493
Family Classic zinc finger, C2H2 0.0077
Further Details:      
 
Domain Number 21 Region: 78-130
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000931
Family Classic zinc finger, C2H2 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000380315-3
Sequence length 1124
Comment ZNF208 (Homo_sapiens) zinc finger protein 208
Sequence
AVTFEDVAVNFSVEEWALLDPSQKKLYRDVMWENFRNVTALDVRAFSTPIYVQLQERNHS
RVNTYICIQSGKVLNSHHDIQKHESAHIGTKFYVWKHSWKSFNNNTLFGNHERTHFVGKP
YKYKQCGNAFSKQNCQMHEQTQTGEKHYICKECGKAFTKHTQYKIHERIHTGEKPYICKQ
CGKAFSRHSDCEIHERTHTGEKPYECKQCGKAFMTQSHCKTHERTHTGEKPYVCNQCGKA
FITQSNCKTHGRIHTGEKPYVCQQCGKAFTRRSDCEIHERTHTGVKPYVCNQCGKPFSRQ
SECKIHERTHTGEKPYVCKQCGKAFSTHGNCQMHKQTHTGEKPYVCKQCGKAFTTHSSCQ
IHERIHTGEKPYVCSQCGKAFMTQNRCKTHEKTHTGEKPYVCQQCGKAFMTQNRCKTHEK
THTGEKPYVCQQCGKAFMTQNRCKTHEKTHTGEKPYVCQQCGKAFMTQNRCKTHEKTHTG
EKPYVCQQCGKAFMTQNRCKTHEKTHTGEKPYVCQQCGKAFMTQNRCKTHEKTHTGEKPY
VCQQCGKAFMTQNRCKTHEKTHTGEKPYVCQQCGKAFMTQNRCKTHEKTHTGEKPYVCQQ
CGKAFMTQNRCKTHEKTHTGEKPYVCQQCGKAFMTQNRCKTHEKTHTGEKPYVCQQCGKA
FMTQNRCKTHEKTHTGEKPYVCQQCGKAFMTQNRCKTHEKTHTGEKPYVCQQCGKAFMTQ
NRCKTHEKTHTGEKPYVCQQCGKAFTTHSSCQIHERIHTGEKPYVCQQCGKAFIRHSECK
IHERTHTGEKPYVCKQCGKAFSTQSHCRRHERTHTGEKPYVCNHCGKAFLRHSHCKTHER
THTGEKPYVCKQCGKAFSWRSECKIHERIHTGEKPYVCNQCGKAFSRHSSCQIHERTHTG
EKPYICKQCGKAFSHHSGCKTHERIHTGEKPYVCKQCGKAFRTHSHFKTHERTHTGEKPH
VCNQCGKAFSRHSECKIHERTHTGEKPYTCQQCGKAFMTQSLCKIHERTHTGEKPYVCNQ
CGKAFSRHSSCQIHERSHTGEKPYMCQQCGKAFTTQSYCQIHERIHTGEKPYVCSQCGKA
FRTRSECKIHERIHTGEKPYVCKQCGKVFSRCSECKIHERTHTG
Download sequence
Identical sequences G5BJ52
HGL_H00000380315-3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]