SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000380315-4 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000380315-4
Domain Number 1 Region: 892-949
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.17e-22
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 2 Region: 253-310
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.85e-22
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 3 Region: 556-613
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.25e-22
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 4 Region: 1010-1061
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.05e-21
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 5 Region: 500-557
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.14e-21
Family Classic zinc finger, C2H2 0.0082
Further Details:      
 
Domain Number 6 Region: 724-781
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.77e-20
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 7 Region: 781-835
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.22e-20
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 8 Region: 948-1003
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.19e-20
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 9 Region: 309-366
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.3e-19
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 10 Region: 668-725
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.34e-19
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 11 Region: 612-669
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.85e-19
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 12 Region: 840-893
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.12e-19
Family Classic zinc finger, C2H2 0.0069
Further Details:      
 
Domain Number 13 Region: 2-57
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.05e-19
Family KRAB domain (Kruppel-associated box) 0.00062
Further Details:      
 
Domain Number 14 Region: 202-254
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.21e-17
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 15 Region: 458-510
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.21e-17
Family Classic zinc finger, C2H2 0.0076
Further Details:      
 
Domain Number 16 Region: 1048-1108
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000367
Family Classic zinc finger, C2H2 0.0095
Further Details:      
 
Weak hits

Sequence:  HGL_H00000380315-4
Domain Number - Region: 398-440
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00016
Family Classic zinc finger, C2H2 0.021
Further Details:      
 
Domain Number - Region: 151-193
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000182
Family Classic zinc finger, C2H2 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000380315-4
Sequence length 1108
Comment ZNF208 (Homo_sapiens) zinc finger protein 208
Sequence
EAVTFEDVAVNFTVEEWALLNPSQKKLYRDVMEETFRNMAAIGRAWDNQEVEEECKNSWR
YLRNVELEKYYQYTAWNQCKEVFLCSRAANVDMKQAGLTPAESLACRAPLVEHLSRNVPI
VAHTALKPYKYLRSEENLYKCDQHGRNCDFQSFQKHSGTKAGEKPCEYDQCGKSYSDLSE
RTHLTDKAFVCKKNLKASSTDSDVQTQERNHSGRKPYVCKQCGKAFTTHRSCEIHERTHT
GEKPYVCKQCGKAFSTQDYWKRHERTHTGEKPYKCKQCGKAFNTQGYCKIHERTHTGEKP
YVCKQCGKAFVTRGDCQIHERIHTGEKPYICKQCRRAFSTHSACQRHERTHTGEKSYVCK
QCGKAFITPHTALKPYKYLRSEENLYKCDQHGRNCDFQSFQKHSGTKAGEKPCEYDQCGK
SYSDLSERTHLTDKAFVCKKNLKASSTDSDVQTQERNHSGRKPYVCKQCGKAFTTHRSCE
IHERTHTGEKPYVCMQCGKAFSTRSACQIHERVHTGEKPYVCKQCGKAFSTRGACQIHER
RHTGEKPYVCKQCGEAFITRGTCQRHERVHTGEKPYVCKQCGKAFSARSACQIHERVHTG
EKPYVCKQCGKAFVTRGDCQIHERIHTGEKPYICKQCRRAFSTHSACQRHERTHTGEKSY
VCKQCGKAFITRGECQRHERVHTGEKPYECKHCGKAFITNSHCRTHEKVHTGDKAYECKE
CGKAFITRGECQRHERIHSGEKPYECKQCGKAFRVQGYCQIHERVHTGEKPYVCKQCGKG
FSRSSCWQTHERAHTGEKPYICKQCGKALSTRSAHQRHERAHTGEKPYVCKQCGKGLSTR
DAYQRHERAHTGEKSYVCKQCGKAFVTRGECQRHERVHTGEKPYVCKQCGKAFSTNSHCQ
IHERVHTGEKPYVCKQCGKAFSTRGYCQIHERVHTGEKPYVCKQCGKAFSTKSRCRTHEK
VHSGEKPYVCKQCGKAFCTHSACQRHERVHTGEKPYVCKQCGKALSTQDAHKRHQRAHTG
EKPYVCKQCGKAFRTNSHCQRHERVHTGEKPYVCKQCGKAFRTNSHCQTHEKVHTGDKPY
IHKQCGTAYITCGYYQINERVHTLEKPY
Download sequence
Identical sequences G5C0F5
HGL_H00000380315-4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]