SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000380386 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000380386
Domain Number 1 Region: 424-549
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000085
Family Tropomyosin 0.0072
Further Details:      
 
Weak hits

Sequence:  HGL_H00000380386
Domain Number - Region: 544-722
Classification Level Classification E-value
Superfamily Tropomyosin 0.000288
Family Tropomyosin 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000380386
Sequence length 927
Comment ERC1 (Homo_sapiens) ELKS/RAB6-interacting/CAST family member 1
Sequence
MYGSARSVGKVEPSNQSPGRSPRLPRSPRLGHRRTNSTGGSSGSSVGGGSGKTLSMENIQ
SLNAAYATSGPMYLSDHENVGSETPKSTMTLGRSGGHLPYGVRMTAMGSSPNIASSGIAS
DTIAFGEHHLPPVSLASTVPHSLRQARDNTIMDLQTQLKEVLRENDLLRKDVEVKESKLS
SSMNSIKTFWSPELKKERALRKDEASKITIWKEQYRVVQEENQHMQMTIQALQDELRIQR
DLNQLFQQDSSSRTGEPCVAELTEENFQRLHAEHERQAKELFLLRKTLEEMELRIETQKQ
TLNARDESIKKLLEMLQSKGLSAKATEEDHERTRRLAEAEMHVHHLESLLEQKEKENNML
REEMHRRFENAPDSAKTKALQTVIEMKDSKISSMERGLRDLEEEIQMLKSNGALSTEERE
EEMKQMEVYRSHSKFMKNKVEQLKEELSSKEAQGEELKKRAAGLQAEIGQVKQELSRKDT
ELLALQTKLETLTNQFSDSKQHIEVLKESLTAKEQRAAILQTEVDALRLRLEEKETMLNK
KTKQIQEMAEEKGTQAGEIHDLKDMLDVKERKVNVLQKKIENLQEQLRDKEKQMSSLKER
VKSLQADTTNTDTALTTLEEALAEKERTIERLKEQRDRDEREKQEEIDNYKKDLKDLKEK
VSLLQGDLSEKEASLLDLKEHASSLASSGLKKDSRLKTLEIALEQKKEECLKMEAQLKKA
HEATLEARASPEMSERIQRLEREISRYKDESSKAQTEVDRLLEILKEVENEKNDKDKKIA
ELERQVKDQNKKVANLKHKEQVEKKKSAQMLEEARRREDNLNDSSQQLQDSLRKKDDRIE
ELEEALRESVQITAEREMVLAQEESARTNAEKQVEELLIAMEKVRQELESMKAKLSSTQQ
SLAEKETHLTNLRAERRKHLEEVLEMK
Download sequence
Identical sequences G5C5Q2
HGL_H00000380386

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]