SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000380394 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000380394
Domain Number 1 Region: 39-96
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.14e-24
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000380394
Sequence length 98
Comment ZNF673 (Homo_sapiens) zinc finger family member 673
Sequence
MQKVVWCSGAVITFIGDLQQATERWTGVPNYNSIQQGRMAMSQESLSFRDVFVDFTLEEW
QQLDSVQKNLYRDVMLENYSHLVSVGYLVGQPDAISLG
Download sequence
Identical sequences G5C2G9
HGL_H00000380394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]